KEGG   Bacillus subtilis subsp. subtilis 168: BSU17410Help
Entry
BSU17410          CDS       T00010                                 

Gene name
cwlC
Definition
(RefSeq) sporulation-specific N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BSU17410 (cwlC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU17410 (cwlC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU17410 (cwlC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU17410 (cwlC)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   BSU17410 (cwlC)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BSU17410 (cwlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 SPOR TBPIP_N MG2
Motif
Other DBs
NCBI-GeneID: 940088
NCBI-ProteinID: NP_389623
Pasteur: BG10825
BSORF: BG10825
UniProt: Q06320
Structure
PDB: 

Position
complement(1872812..1873579)
Genome map
AA seq 255 aa AA seqDB search
MVKIFIDPGHGGSDPGATGNGLQEKTLTLQIALALRTILTNEYEGVSLLLSRTSDQYVSL
NDRTNAANNWGADFFLSIHVNSGGGTGFESYIYPDVGAPTTTYQSTIHSEVIQAVDFADR
GKKTANFHVLRESAMPALLTENGFIDTVSDANKLKTSSFIQSLARGHANGLEQAFNLKKT
SSSGLYKVQIGAFKVKANADSLASNAEAKGFDSIVLLKDGLYKVQIGAFSSKDNADTLAA
RAKNAGFDAIVILES
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaatttttattgatcctggccatggcgggtctgatccaggcgcaacaggtaat
ggccttcaggagaaaacgttaaccctgcaaatcgctttagccttacgtacgatattaact
aatgaatatgaaggcgtttctctgctgctgagccggacaagcgaccaatatgtcagctta
aacgaccggacaaatgccgcaaataactggggagcagatttctttttgtccattcacgtt
aattccgggggaggcacaggttttgaaagctatatttatccagatgtaggagccccgacg
acgacttatcaatcgacaattcactctgaagtgatacaagctgtcgactttgccgatcgc
ggcaaaaaaacagcgaacttccacgtcctaagggagtcggcaatgcctgccctcttgacc
gagaacggcttcattgataccgtttccgatgcaaataagctgaaaacgagcagttttatt
caaagcttagcgagaggacatgcaaacgggctggagcaagcctttaaccttaaaaagact
tccagctcagggttatataaggttcaaatcggcgcatttaaagtcaaagcgaatgccgac
tcgctcgcaagtaatgccgaagccaaaggttttgactcgattgtccttttaaaggacgga
ttatacaaagtgcagattggcgcattttcatccaaagacaatgcagacaccctcgctgcc
agagcgaaaaatgccggctttgacgctattgtgatcctagaatcatag

DBGET integrated database retrieval system