KEGG   Bacillus subtilis subsp. subtilis 168: BSU17440
Entry
BSU17440          CDS       T00010                                 

Gene name
ynbB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Met_gamma_lyase Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2
Other DBs
NCBI-GeneID: 940047
NCBI-ProteinID: NP_389626
Pasteur: BG12264
BSORF: BG12264
UniProt: P94479
Position
1876584..1877849
AA seq 421 aa
MFDTLTHGELLKKTAMEVEADIAGIHKQIEEISERNEWRVLQSYRKHKVSDTHFTPSTGY
GYDDIGRDTLESIYADVFGGEAGLVRPQIISGTHAISIALFGVLRPGDELLYITGKPYDT
LEEIVGVRGGENAGSLKDFQIGYNAVDLTKDGKIDYDAVAAAINPKTKVIGIQRSKGYAN
RPSFLISEIKEMIRFVKEINENLIVFVDNCYGEFVEELEPCHVGADLMAGSLIKNPGGGL
AKTGGYLVGKAKWIEACSYRMTSPGIGREAGASLYSLQEMYQGFFLAPHVVSQSLKGAVF
TARFLEKLGFTSNPKWDAKRTDLIQSVEFSDREKMIAFCQAIQFASPINAHVTPYPAYMP
GYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKNAICSAVDSLMQKQL
I
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtttgacacattaacacacggagaattattgaagaaaacggcaatggaagtggaagcg
gacattgccggcattcataaacaaatagaagaaatcagcgagcgaaatgagtggagagtg
cttcaaagctatagaaaacacaaagtaagcgacactcatttcacgccgtctactggatac
ggctatgatgatatcggaagagacacgcttgaaagcatatatgcggatgtgtttggcgga
gaagcggggcttgtaaggccgcaaatcatttcaggcacacatgccatctcaattgctttg
ttcggtgtcctcagaccgggggacgagctcctttatatcacgggcaagccgtatgatacg
ctagaggaaattgtgggcgtcaggggtggagaaaacgctggttcgttaaaggattttcaa
atcggctataatgcggttgatctgacgaaagacggaaagatagactatgatgcagtcgcc
gctgcgatcaatccgaagacaaaagtaatcggcattcagcgctcaaaaggatatgcgaat
cgcccttctttcttaattagtgaaataaaagaaatgatccgttttgtaaaagaaatcaat
gaaaatctgatcgtctttgtggacaactgttacggagaatttgtggaagagcttgagcct
tgccatgtcggagccgacctgatggcgggatctctcattaaaaatcccggcggcggcctt
gcgaaaacaggcggctacctcgtcggaaaagcgaaatggattgaagcttgctcataccgt
atgacgtcacccggcatcggcagagaagcgggggcatctctttactcgctccaagaaatg
taccaaggcttctttttggcgcctcacgttgtgtctcaaagtttaaagggagcggtgttt
acagcgagattccttgaaaaactcggcttcacttcaaacccgaaatgggatgcgaaaaga
acggatttaatacaatccgttgagttttctgacagagaaaagatgattgctttttgccag
gctattcaatttgcatcgccaatcaatgctcatgtgacgccttatccagcctacatgcct
ggatacgaggatgatgtcattatggcagcagggacgtttattcaaggagcaagcatcgaa
ttatcagctgatggccctatccgcccgccgtatgtagcgtatgttcagggaggattaacc
tattcgcatgtgaagaatgccatatgcagtgcagtggattcattgatgcaaaagcaatta
atttaa

DBGET integrated database retrieval system