KEGG   Bacillus subtilis subsp. subtilis 168: BSU17450
Entry
BSU17450          CDS       T00010                                 

Gene name
glnR
Definition
(RefSeq) MerR family transcriptional regulator
  KO
K03713  MerR family transcriptional regulator, glutamine synthetase repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU17450 (glnR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   MerR family
    BSU17450 (glnR)
SSDB
Motif
Pfam: MerR_1 MerR DUF5572 GABP-alpha S_100 Plasmid_parti
Other DBs
NCBI-GeneID: 940070
NCBI-ProteinID: NP_389627
Pasteur: BG10424
BSORF: BG10424
UniProt: P37582
Structure
PDB: 
4R4E

Position
1877959..1878366
AA seq 135 aa
MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARSEGNRRLFSFHDVDKLLEI
KHLIEQGVNMAGIKQILAKAEAEPEQKQNEKTKKPMKHDLSDDELRQLLKNELMQAGRFQ
RGNTFRQGDMSRFFH
NT seq 408 nt   +upstreamnt  +downstreamnt
atgagtgataatattcgccgctcaatgcctttatttccaataggaattgtcatgcagtta
actgagttatcagcaagacaaattcgatattatgaggaaaatggactgatatttccagcc
agaagtgaaggaaatagacgattattttcatttcatgatgtagataaactgttagaaatc
aagcacctgatagaacaaggtgtaaacatggcaggaattaaacagattctggcgaaagcc
gaagccgagccagaacaaaaacaaaacgagaagacgaaaaaaccaatgaaacatgatctg
tccgatgacgaactgagacagctcctgaaaaacgagctcatgcaagccggccgttttcaa
agagggaatacattccgtcaaggcgacatgtcccgcttctttcattaa

DBGET integrated database retrieval system