KEGG   Bacillus subtilis subsp. subtilis 168: BSU17460
Entry
BSU17460          CDS       T00010                                 

Gene name
glnA
Definition
(RefSeq) glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01230  Biosynthesis of amino acids
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU17460 (glnA)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU17460 (glnA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU17460 (glnA)
   00220 Arginine biosynthesis
    BSU17460 (glnA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU17460 (glnA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU17460 (glnA)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     BSU17460 (glnA)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU17460 (glnA)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N
Other DBs
NCBI-GeneID: 940020
NCBI-ProteinID: NP_389628
Pasteur: BG10425
BSORF: BG10425
UniProt: P12425
Structure
PDB: 

Position
1878425..1879759
AA seq 444 aa
MAKYTREDIEKLVKEENVKYIRLQFTDILGTIKNVEIPVSQLGKALDNKVMFDGSSIEGF
VRIEESDMYLYPDLNTFVIFPWTAEKGKVARFICDIYNPDGTPFEGDPRNNLKRILKEME
DLGFSDFNLGPEPEFFLFKLDEKGEPTLELNDKGGYFDLAPTDLGENCRRDIVLELEEMG
FEIEASHHEVAPGQHEIDFKYAGAVRSCDDIQTFKLVVKTIARKHGLHATFMPKPLFGVN
GSGMHCNLSLFKNGVNAFFDENADLQLSETAKHFIAGIVKHATSFTAVTNPTVNSYKRLV
PGYEAPCYVAWSAQNRSPLIRIPASRGISTRVEVRSVDPAANPYLALSVLLAAGLDGIKN
KLEAPAPIDRNIYVMSKEERMENGIVDLPATLAEALEEFKSNEVMVKALGEHLFEHFIEA
KEIEWDMFRTQVHPWEREQYMSQY
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggcaaagtacactagagaagatatcgaaaaattagtaaaagaagaaaacgtgaagtat
atccgccttcaatttactgacattcttggaacaatcaagaatgttgagattcctgtaagc
cagcttggaaaagcgcttgataataaagtcatgtttgacggttcttctattgagggattc
gttcgtatcgaagagtcagacatgtacctgtatccagatctaaatacatttgttatcttc
ccatggacagctgaaaaaggtaaagtagcacgtttcatctgtgatatttacaatccggat
ggcacaccttttgaaggtgacccgcgaaacaacttaaaacggattctgaaagaaatggaa
gacctcggcttcagtgattttaaccttgggcctgagcctgaattcttcttattcaaattg
gacgaaaaaggcgagccgacgcttgaactaaacgacaaaggcggatatttcgacttagct
ccaactgatttaggagaaaactgccgccgcgatatcgtacttgagcttgaagagatgggc
tttgaaatcgaagcgtctcaccacgaagtagcacctggtcagcacgaaatcgactttaaa
tatgctggagcagtccgctcttgtgatgacatccaaacatttaaactagttgtcaaaaca
attgcccgtaaacacggcctgcatgcgacatttatgccaaaaccattgttcggtgtaaac
ggttcaggtatgcactgcaatctatcactcttcaaaaatggtgttaacgcattctttgac
gaaaacgcagatcttcagttaagtgaaacagcgaagcacttcattgcaggtatcgtgaag
cacgcaacaagctttacagcagtaacaaacccgacagtaaactcttacaaacgtcttgtt
cctggctatgaagcaccttgttatgtagcatggagcgcgcaaaacagaagcccgcttatc
cgtatcccggcttctcgcggcatcagcacacgtgttgaagtacgcagtgtagacccagct
gcaaacccataccttgcacttagcgtattgcttgctgcaggattagacggaatcaaaaac
aaactggaagcgccggctccaatcgaccgcaacatctatgtgatgagcaaagaagagcgc
atggaaaacggaatcgttgaccttccagcaacacttgcggaagcactagaagaattcaaa
tcaaacgaagtcatggtcaaagcgctgggcgagcacctattcgaacacttcatcgaagca
aaagaaatcgaatgggatatgttccgcacgcaagtacatccttgggaacgcgaacagtat
atgtctcagtattaa

DBGET integrated database retrieval system