KEGG   Bacillus subtilis subsp. subtilis 168: BSU17470
Entry
BSU17470          CDS       T00010                                 

Gene name
ynxB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939610
NCBI-ProteinID: NP_389629
Pasteur: BG11074
BSORF: BG11074
UniProt: P31844
Position
1880087..1880377
AA seq 96 aa
MKKLTIFSGGLGAVFSVLAQLFAVIDDSYTLGNLWFLGALAGIITMLASIQTNNKPVFSI
LLIASSVIGLLGTGLVYIIPTLFNIIIIYKFSKVSQ
NT seq 291 nt   +upstreamnt  +downstreamnt
atgaaaaaattgactatcttctccgggggattaggagcggttttttctgtactggctcaa
ctgtttgcggttatagatgactcttacactttggggaatttatggtttttaggtgctttg
gcgggaattataaccatgcttgcttcaatccagacaaataataaaccagtcttcagcata
ttattaattgctagttcagtaataggtctacttggaactggtcttgtatacatcatacca
acactgttcaatataataataatttataaattttcaaaagtaagccaataa

DBGET integrated database retrieval system