KEGG   Bacillus subtilis subsp. subtilis 168: BSU17480
Entry
BSU17480          CDS       T00010                                 

Gene name
ynzF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4872
Other DBs
NCBI-GeneID: 939642
NCBI-ProteinID: NP_389630
Pasteur: BG13469
BSORF: BG13469
UniProt: O31799
Position
1880623..1880967
AA seq 114 aa
MWKALSQLLKKQKNQSPSDEDYIQIPELEVKVLGMLHSINIDLVNVIAQAEKSKEFIGQI
EGIWHSIANQFYSLAQGFENEDINKLSADLDHAAATWEAVANKAKEFVTNSYQG
NT seq 345 nt   +upstreamnt  +downstreamnt
gtgtggaaagctttaagtcaattactcaagaaacagaaaaatcaaagtccaagcgatgaa
gattatatacagattccagaattagaagtaaaagttttggggatgcttcacagtatcaat
atagacctggttaatgtaatagcccaagcagaaaagtctaaggagtttataggacaaatc
gaaggcatctggcattctatagcaaatcaattttattcactcgcccaagggtttgagaat
gaggatatcaataagctttctgcggatcttgatcatgctgccgccacttgggaagctgtt
gctaataaagcaaaagagtttgtaacaaattcataccaagggtaa

DBGET integrated database retrieval system