KEGG   Bacillus subtilis subsp. subtilis 168: BSU17490
Entry
BSU17490          CDS       T00010                                 

Gene name
ynzG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: bPH_5 Nas2_N TMEM100
Other DBs
NCBI-GeneID: 938126
NCBI-ProteinID: NP_389631
Pasteur: BG13470
BSORF: BG13470
UniProt: O31800
Position
1881098..1881349
AA seq 83 aa
MLGINVEKSNENLIINWQLSKIEIPIKEINDVFLDPNYGGEEKSAVRIGFPYGSTDRVVI
KTARNTYILFTTNPALIMSKIVS
NT seq 252 nt   +upstreamnt  +downstreamnt
atgcttggaatcaacgttgaaaaatcaaatgaaaacttaattatcaattggcagctatcc
aaaattgaaattccaatcaaagaaatcaatgatgtatttcttgatccaaactatggggga
gaggagaaaagcgcagtaaggattgggtttccttatggctcaacagatagggtagtaatt
aaaacagcacgtaacacttacattttgttcaccactaatcctgctttaattatgagtaaa
attgtttcttaa

DBGET integrated database retrieval system