KEGG   Bacillus subtilis subsp. subtilis 168: BSU17500
Entry
BSU17500          CDS       T00010                                 

Gene name
ynaB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SUKH_6 SMI1_KNR4 SUKH_5
Other DBs
NCBI-GeneID: 940017
NCBI-ProteinID: NP_389632
Pasteur: BG12254
BSORF: BG12254
UniProt: P94480
Position
1881536..1881970
AA seq 144 aa
MEDATFHFKDPASPQEISDIEQKLGVTFPNDYKEFLLQHNGMEMFDGIEILSLEGIIEYN
EVQDFPEGYVLIGYHFDGRYVIDTNKSKNGLGYMLYLDSIDDIEDAINLDSNFEIWFDML
VSLNGTKYWEVNPNLQEYYKLVSE
NT seq 435 nt   +upstreamnt  +downstreamnt
atggaagatgctacttttcatttcaaagatcctgctagtcctcaagaaattagcgatata
gaacagaagctaggtgttactttccctaatgactataaagagtttttgttacagcacaat
gggatggaaatgtttgatgggattgaaatacttagcttagagggaatcattgaatataat
gaggttcaagatttcccagagggatacgttttaattggatatcattttgatggaagatat
gtcatagacacaaacaaatcaaaaaatggattaggctatatgctatatctagactcaatt
gatgatattgaagatgcgattaacttagattctaatttcgagatatggtttgatatgcta
gtgtctttaaatggaacgaaatattgggaagtaaatccgaatctccaagagtattataaa
ctggtttcagaataa

DBGET integrated database retrieval system