KEGG   Bacillus subtilis subsp. subtilis 168: BSU17510
Entry
BSU17510          CDS       T00010                                 

Gene name
ynaC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SmaI PRESAN
Other DBs
NCBI-GeneID: 936647
NCBI-ProteinID: NP_389633
Pasteur: BG12255
BSORF: BG12255
UniProt: P94481
Position
1882040..1882831
AA seq 263 aa
MTIYEQIKDALKNKINELVSPQEVKKTLQEKYGTNPDSIILSDYCYNRYNKGISFNKHLF
EYMNRSSYKYLGENSLYTGLIFRKSKGEDKEVIVGEWVNGVKSLREASVTNNQINDQAEI
ISKEQLVNLYNEYNQILRYEMNVLNCKPTELRHLIGRIGEFICAIQTNGTLARQTNQHGF
DVVSDGRRISVKTTAQSSGFISINKNTFYDFDDFFVVQYVNDDFKVIFFGSKEEVQKISR
IYGSQYEVEISLLKKLNKEYQLN
NT seq 792 nt   +upstreamnt  +downstreamnt
atgacaatttacgagcaaattaaggatgctttgaaaaataagatcaatgagttggtttca
cctcaagaagtaaagaaaacccttcaagaaaaatacggaactaatccggatagcattatt
ttatcagattattgttataaccggtataataaggggatttcttttaataagcacctcttt
gaatatatgaatagaagttcttacaaatacttaggtgaaaactctctttatacaggactt
attttcagaaaatcaaaaggggaagataaggaagttatcgtaggcgaatgggtaaacggt
gttaaatcactccgagaagcttctgttactaataaccaaataaatgatcaagccgaaatc
attagtaaagaacaacttgtaaacctttataatgaatataaccaaatcctgagatatgaa
atgaatgtattgaactgtaagcctacagaattgaggcatttaattggcagaatcggtgaa
ttcatttgtgcaatccaaaccaacggcactctggcacgtcaaactaatcagcatggattt
gatgttgtgagtgatggcagacggattagtgtaaaaacaacagctcaatcaagtggtttt
atttcgataaataaaaatacattttatgattttgatgatttttttgtagttcaatacgta
aatgatgattttaaagttattttcttcggctcaaaggaagaagtgcaaaaaataagcaga
atttatggaagccaatacgaagttgaaatttcacttcttaaaaagcttaataaggaatac
caattaaattaa

DBGET integrated database retrieval system