KEGG   Bacillus subtilis subsp. subtilis 168: BSU17520
Entry
BSU17520          CDS       T00010                                 

Gene name
ynaD
Definition
(RefSeq) N-acetyltransferase YnaD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 Acetyltransf_4 Acetyltransf_8 FR47
Other DBs
NCBI-GeneID: 936242
NCBI-ProteinID: NP_389634
Pasteur: BG12256
BSORF: BG12256
UniProt: P94482
Position
1883166..1883678
AA seq 170 aa
MHITTKRLLIREFEFKDWQAVYEYTSDSNVMKYIPEGVFTEEDAKAFVNKNKGDNAEKFP
VILRDEDCLIGHIVFYKYFGEHTYEIGWVFNPNYQNKGYASEAAQAILEYGFKEMNLHRI
IATCQPENIPSYRVMKKIGMRREGFFKKCIPKGNEWWDEYYYAILEEEWN
NT seq 513 nt   +upstreamnt  +downstreamnt
atgcacataacaacaaaaaggttattgatacgtgaatttgaattcaaagattggcaagca
gtatatgagtatacatctgatagtaatgtaatgaagtatatacctgaaggggtttttact
gaagaagatgcaaaggcatttgtaaataaaaacaaaggtgataacgctgaaaaattccct
gtcatactaagagatgaagactgtcttataggccatattgttttttataagtattttggt
gaacatacatatgaaattgggtgggtgtttaatcccaattatcaaaataaagggtatgct
tctgaggcagcccaagctatcttggaatatggatttaaagaaatgaacttacataggatt
atagctacgtgtcaacctgagaatattccctcataccgagttatgaagaagattggaatg
agaagagaaggcttttttaaaaaatgtattccaaaaggcaatgaatggtgggatgaatat
tattacgctattttagaggaagagtggaattga

DBGET integrated database retrieval system