KEGG   Bacillus subtilis subsp. subtilis 168: BSU17530
Entry
BSU17530          CDS       T00010                                 

Gene name
ynaE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3885
Other DBs
NCBI-GeneID: 936948
NCBI-ProteinID: NP_389635
Pasteur: BG12257
BSORF: BG12257
UniProt: P94483
Position
1884238..1884879
AA seq 213 aa
MNLIGYIEERFQNLELIPSIYNQWGTGIHFCLGENIYQLKANEELNLKMFRIVYEQTSII
FNELFEQNDDIFLVTNMYKHKKKEKCIRKLKVYQPFLKCKNHLNQIMVKTYPYPFEINKA
EEYEMQQFSLLCKPRDLRVTELLKAASNEDFPQKPKFGGYSIDYPDVFFVNITKDIIFFI
YDDRGCEVIAHDFKRIRPLYEKYHDWVEEYKCM
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaatttaatagggtatattgaggaaaggtttcaaaacctcgaattaattcctagcatc
tataatcaatggggcacaggaatccatttttgtcttggggaaaatatctatcaactcaaa
gcaaatgaagaattgaatttaaagatgtttcggattgtatatgaacaaacctcaatcatt
tttaatgaattatttgaacaaaatgatgacatattccttgtgacgaatatgtataagcac
aaaaagaaagagaaatgtataagaaaattaaaggtgtatcaaccgtttctaaaatgtaaa
aatcatttgaatcaaattatggtgaagacatatccctatcctttcgaaatcaataaagct
gaagaatacgagatgcaacaattttccctgttatgcaaacctcgagacttacgtgtaact
gaattacttaaagcagccagtaatgaggattttccacaaaaaccgaaattcggaggttac
tctattgattaccctgatgttttctttgtgaacattacaaaagacattattttctttatc
tatgatgaccgcggatgcgaagtcatagctcatgatttcaaacgaatacgtccactttat
gaaaaatatcacgactgggtagaagagtataagtgcatgtaa

DBGET integrated database retrieval system