KEGG   Bacillus subtilis subsp. subtilis 168: BSU17540
Entry
BSU17540          CDS       T00010                                 

Gene name
ynaF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938101
NCBI-ProteinID: NP_389636
Pasteur: BG12258
BSORF: BG12258
UniProt: P94484
Position
1884968..1885321
AA seq 117 aa
MVLCDDERSAFLLVLDERLVDFDSQGGNHISVYLVTHFELSDQSYKDVLSFNDDLLGMEH
NCSYAMDILSVKEELDFDFPFNMLAIKSYVQELIKMLGIDITLPEMKERDFDKLSQN
NT seq 354 nt   +upstreamnt  +downstreamnt
atggtattatgtgatgatgagagatctgcatttttattagtacttgatgaaagattagtg
gattttgattctcaaggtggaaaccatattagtgtttatttagttactcactttgagtta
tctgatcaatcgtataaagatgtattaagctttaatgatgatcttttgggtatggagcat
aactgttcgtatgcaatggatattctaagcgttaaagaggaacttgatttcgatttccca
tttaatatgcttgcaataaaaagctatgtacaagaattaataaaaatgttagggattgat
atcactctgcctgaaatgaaagaaagagattttgacaaactttctcaaaactaa

DBGET integrated database retrieval system