KEGG   Bacillus subtilis subsp. subtilis 168: BSU17550Help
Entry
BSU17550          CDS       T00010                                 

Gene name
ynaG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1700
Motif
Other DBs
NCBI-GeneID: 940014
NCBI-ProteinID: NP_389637
Pasteur: BG12259
BSORF: BG12259
UniProt: P94485
Position
1885365..1885640
Genome map
AA seq 91 aa AA seqDB search
MNVKKAAAVFSITIPIISAILIINFFTGFMSIPWQGMPVFFPLLLSPIGIILAFVSIKTN
KRCAVYGIVLNAIMFPFPFFWFIGGALLFGV
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttaaaaaagctgcagctgttttttcaatcactattccaattatctcagccatc
ttaattattaatttttttacaggatttatgtcaattccatggcaaggaatgccggtgttt
tttccattattactttctcctataggaatcattttagcgttcgtttcaataaagacaaat
aaacggtgtgctgtatatgggattgtcttaaatgcaattatgtttccatttccttttttc
tggtttatcggaggggctttgttatttggagtttaa

DBGET integrated database retrieval system