KEGG   Bacillus subtilis subsp. subtilis 168: BSU17560
Entry
BSU17560          CDS       T00010                                 

Gene name
ynaI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: OxoGdeHyase_C Glft2_N MdcG
Other DBs
NCBI-GeneID: 940011
NCBI-ProteinID: NP_389638
Pasteur: BG12261
BSORF: BG12261
UniProt: P94487
Position
1886057..1886527
AA seq 156 aa
MKLYNEFINIAKTFNKELDIIPLLYGSLGLEKVTGLDFSPEDIDLLIPLIFLEEKWEKLK
KVMELHGYKMVDLHEHEFKKTNTKIGISYIEDLKPFADVDYNNLEIFEDGGAKYHLLTID
DYLKIYKKSLLDGYRRRKKNHKDQSKINILNKLIRN
NT seq 471 nt   +upstreamnt  +downstreamnt
atgaagttgtataatgaatttatcaatatagctaaaacgtttaataaagagttagacata
attccattattatatggatctttaggtcttgaaaaggtaactgggttagacttttcccca
gaagatattgatctccttattcctttaatttttttagaggaaaagtgggaaaaactaaaa
aaagtgatggaactgcatggatacaaaatggttgatttacatgagcatgaatttaagaaa
actaatacaaaaataggcatttcttacattgaggatttaaaaccatttgcagatgtagac
tataataacctagagatttttgaagatggcggagcgaaatatcatttgctaacgattgat
gattacctcaagatttataaaaagtctttattagatggttatagaagaaggaagaagaat
cataaagaccaaagtaaaattaacatattgaataaattaatacggaattaa

DBGET integrated database retrieval system