KEGG   Bacillus subtilis subsp. subtilis 168: BSU17570
Entry
BSU17570          CDS       T00010                                 

Gene name
xynP
Definition
(RefSeq) symporter
  KO
K03292  glycoside/pentoside/hexuronide:cation symporter, GPH family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU17570 (xynP)
SSDB
Motif
Pfam: MFS_2 MFS_1 MFS_1_like DUF1118
Other DBs
NCBI-GeneID: 939533
NCBI-ProteinID: NP_389639
Pasteur: BG12262
BSORF: BG12262
UniProt: P94488
Position
1887352..1888743
AA seq 463 aa
MLSENVKKISMVEKVGYASGDFACNLIYATVSTYLLFFYTDVFGLSAAAAGTMFLVVRII
DALADPFIGTIVDRTNSRFGRFRPYLLFGAFPFVILAILCFTTPDFSDMGKLIYAYITYV
GLSLTYTTINVPYGALTSAMTRNNQEVVSITSVRMLFANLGGLVVAFFVPLLAAYLSDTS
GNESLGWQLTMGILGMIGGCLLIFCFKSTKERVTLQKSEEKIKFTDIFEQFRVNRPLVVL
SIFFIIIFGVNSISNSVGIYYVTYNLEREDLVKWYGLIGSLPALVILPFIPRLHQFLGKK
KLLNYALLLNIIGLLALLFVPPSNVYLILVCRLIAAAGSLTAGGYMWALIPETIEYGEYR
TGKRMGGLIYAIIGFFFKFGMALGGVVPGLVLDKFGYVANQAQTPAALMGILITTTIIPV
FLLVLALIDINFYNLDEKKYKNMVRELENRDKVYLDHIDDFKA
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgctcagtgaaaatgtaaagaagattagcatggttgaaaaagttggatatgcgtctgga
gattttgcttgtaatttaatttatgcaacagtgtctacgtatcttttgttcttctataca
gatgtttttggtttatcggcagcagcagccggtactatgtttttagtggttagaataatc
gacgctctcgctgatccttttatcggaacaatagttgacagaacgaacagcagatttgga
cgctttagaccgtatcttttattcggagcttttccatttgtcatactggcaatactctgt
tttacaacaccagacttttcggatatggggaaattaatatatgcctatataacctatgtt
ggcttgtcgcttacatacacaacgataaacgttccatatggcgcgttaacttctgcaatg
actagaaataatcaagaagttgttagtataacttctgttcgcatgttatttgcgaatctt
gggggacttgtcgttgcattttttgttcccttactggctgcttatttaagcgatacttcc
ggcaacgagtctcttggctggcaactaaccatgggtattttgggaatgataggcgggtgc
cttttaatcttttgttttaaaagcacaaaagagcgggtcactcttcaaaaatccgaagag
aaaattaaatttacggatatatttgagcagtttcgtgttaatcgtccacttgttgtatta
agtattttctttattattatttttggagtgaattccatcagtaattcggttggcatttac
tacgtaacgtataacttagaaagagaggatttggtgaagtggtacggtttgataggaagt
ttacccgctttggtcattttaccgtttattccaaggcttcatcaatttttggggaaaaag
aaattactaaactatgcattattactgaatattataggcctcttagctttactgtttgtt
ccgccaagtaatgtttacctcatacttgtctgtcgattaatcgctgctgctggaagtctc
actgccgggggatatatgtgggcgcttattcctgaaacaattgaatatggagagtacagg
actgggaaaagaatgggtgggctcatttacgctataatcggatttttctttaagtttggt
atggccttaggaggagttgttccgggtctggttcttgataagtttggatatgtagcaaat
caggcacaaaccccggcggccttaatggggattttaattacaacaaccattattcccgtg
ttcttgcttgttctagctttaattgatattaatttctataacttagatgagaaaaaatat
aaaaacatggttcgagaattagagaatagagacaaagtttatttggatcatattgatgat
ttcaaggcttaa

DBGET integrated database retrieval system