KEGG   Bacillus subtilis subsp. subtilis 168: BSU17580Help
Entry
BSU17580          CDS       T00010                                 

Gene name
xynB
Definition
(RefSeq) beta-xylosidase
  KO
K01198  xylan 1,4-beta-xylosidase [EC:3.2.1.37]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU17580 (xynB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.37  xylan 1,4-beta-xylosidase
     BSU17580 (xynB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_43 GH43_C2 DUF1349 DUF4298
Motif
Other DBs
NCBI-GeneID: 939472
NCBI-ProteinID: NP_389640
Pasteur: BG11987
BSORF: BG11987
UniProt: P94489
Structure
PDB: 

Position
1888774..1890375
Genome map
AA seq 533 aa AA seqDB search
MKITNPVLKGFNPDPSICRAGEDYYIAVSTFEWFPGVQIHHSKDLVNWHLVAHPLQRVSQ
LDMKGNPNSGGVWAPCLSYSDGKFWLIYTDVKVVDGAWKDCHNYLVTCETINGDWSEPIK
LNSSGFDASLFHDTDGKKYLLNMLWDHRIDRHSFGGIVIQEYSDKEQKLIGKPKVIFEGT
DRKLTEAPHLYHIGNYYYLLTAEGGTRYEHAATIARSANIEGPYEVHPDNPILTSWHDPG
NPLQKCGHASIVQTHTDEWYLAHLTGRPIHPDDDSIFQQRGYCPLGRETAIQKLYWKDEW
PYVVGGKEGSLEVDAPSIPETIFEATYPEVDEFEDSTLNINFQTLRIPFTNELGSLTQAP
NHLRLFGHESLTSTFTQAFVARRWQSLHFEAETAVEFYPENFQQAAGLVNYYNTENWTAL
QVTHDEELGRILELTICDNFSFSQPLNNKIVIPREVKYVYLRVNIEKDKYYYFYSFNKED
WHKIDIALESKKLSDDYIRGGGFFTGAFVGMQCQDTSGNHIPADFRYFRYKEK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaccaatcccgtacttaaaggattcaatcccgatccaagtatttgtagagca
ggagaggattattatatcgctgtatctacatttgagtggtttccgggagtccagatacac
cactcaaaagatttagtaaattggcacttagttgcacatccattacagagagtttcacaa
ttagacatgaaaggaaacccaaattcaggtggagtttgggcaccatgtttaagctatagt
gatgggaagttttggctgatctatacggatgttaaggtagtagatggcgcatggaaagat
tgtcacaattatttagttacttgtgaaacgattaatggtgattggagtgagccgattaaa
ttaaatagctcggggtttgatgcttctttgttccatgatacggatggaaaaaagtattta
ttaaatatgttatgggatcaccgtattgatcggcactcatttggaggaattgttatacag
gaatattctgataaagagcaaaaattaatcggtaaaccaaaagttatatttgaaggaact
gatagaaaactgacagaagctccgcatctttatcatatcgggaactattattatttatta
actgcagaaggaggaacacggtacgaacatgctgctacaattgctcgttctgcaaatatt
gaggggccatatgaagttcatcccgataatccaattttaacgtcatggcatgacccagga
aatccattgcaaaaatgtggtcatgcatccattgttcaaacacatacagatgagtggtat
ttagctcatttaacgggacgtcctattcatcctgacgatgattcaatttttcagcagaga
ggatactgtcctttgggcagagaaacagctattcaaaaactttactggaaagatgaatgg
ccctatgtagtaggtggaaaagaaggaagcttggaggtagatgcaccttctatacccgaa
acaatatttgaagcaacgtacccggaagttgatgaatttgaggattcaacattaaatata
aattttcaaactttaaggattccattcacgaatgaattaggttcattgactcaagcgcca
aatcatttacgattattcggtcatgaatcattgacctcgacatttactcaggcatttgta
gccagacgctggcaaagtctccattttgaagccgaaactgctgttgagttttatccggaa
aattttcaacaagccgctgggttggtgaattactacaatacagagaactggacggctctt
caagtcacgcatgatgaagaacttgggcgcattcttgaattaacaatatgtgacaacttt
tctttttcacagccattaaataataaaattgttattcctcgtgaagtaaagtatgtatat
ttaagagtaaatattgaaaaggacaaatattattatttctattcttttaacaaagaagat
tggcacaaaattgacattgcactggaatcgaaaaaattatcagatgattatatccgtggg
ggaggattcttcacaggggcctttgtagggatgcaatgccaagataccagtggtaatcat
attccggccgactttagatattttcgttataaagaaaaataa

DBGET integrated database retrieval system