KEGG   Bacillus subtilis subsp. subtilis 168: BSU17610Help
Entry
BSU17610          CDS       T00010                                 

Gene name
xylB
Definition
(RefSeq) xylulose kinase
  KO
K00854  xylulokinase [EC:2.7.1.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU17610 (xylB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     BSU17610 (xylB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-GeneID: 939560
NCBI-ProteinID: NP_389643
Pasteur: BG10807
BSORF: BG10807
UniProt: P39211
Position
1893396..1894895
Genome map
AA seq 499 aa AA seqDB search
MKYVIGIDLGTSAVKTILVNQNGKVCAETSKRYPLIQEKAGYSEQNPEDWVQQTIEALAE
LVSISNVQAKDIDGISYSGQMHGLVLLDQDRQVLRNAILWNDTRTTPQCIRMTEKFGDHL
LDITKNRVLEGFTLPKMLWVKEHEPELFKKTAVFLLPKDYVRFRMTGVIHTEYSDAAGTL
LLHITRKEWSNDICNQIGISADICPPLVESHDCVGSLLPHVAAKTGLLEKTKVYAGGADN
ACGAIGAGILSSGKTLCSIGTSGVILSYEEEKERDFKGKVHFFNHGKKDSFYTMGVTLAA
GYSLDWFKRTFAPNESFEQLLQGVEAIPIGANGLLYTPYLVGERTPHADSSIRGSLIGMD
GAHNRKHFLRAIMEGITFSLHESIELFREAGKSVHTVVSIGGGAKNDTWLQMQADIFNTR
VIKLENEQGPAMGAAMLAAFGSGWFESLEECAEQFIREAAAFYPKAQNVQKYKTLFDLYK
NIYTHTKDLNTALKSFRKN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgtcattggaatagatcttggaacgagtgctgttaaaaccattttagttaac
caaaacggcaaggtttgtgcagaaacgtccaaaaggtatccgctcatccaagagaaggcg
ggatatagtgagcaaaatcctgaagactgggttcagcaaacaattgaagcattggctgaa
ttggtttctatatccaatgttcaagccaaggatattgacgggataagctattcgggacaa
atgcatggattagtactgcttgaccaagatcgtcaggtgttacgtaatgcaattctttgg
aatgataccagaacaacgcctcaatgtataaggatgaccgagaaatttggcgatcatctt
cttgacatcacaaaaaaccgtgttttagaagggtttacattacctaaaatgttatgggta
aaggaacatgaacctgaactttttaaaaaaactgctgtgtttttgcttccgaaagactac
gtgcgattccgtatgaccggtgtcattcacaccgaatactccgatgcagcaggaacttta
cttttacatattactcgcaaggagtggagcaatgatatttgcaatcaaattggtatttct
gcagatatttgtcctccgcttgttgaatctcatgattgtgtaggatcgctgcttccgcac
gttgccgcgaagaccgggctattagaaaaaacaaaagtgtacgctgggggagcagataat
gcttgcggcgctattggagcaggtatcctttcttccggaaaaacattatgcagtattggg
acgtcaggggtcatactttcctacgaagaagaaaaagaaagagactttaaagggaaagtc
cacttttttaatcatggaaaaaaggattctttttatacgatgggcgtcacgctcgctgca
ggatacagcttggactggtttaaaagaacgtttgcaccaaacgaatcgtttgagcaatta
ttgcagggggtggaagctattccgataggagccaatggactgctatacactccttatttg
gttggtgaaagaacgccgcatgctgattcttctattcggggaagcttgatcggaatggat
ggagcccataatagaaagcattttttgagggcaataatggaaggtatcacattctcttta
catgaatcaattgagctattccgcgaagcgggaaaatcagttcatactgttgtttctatt
ggtgggggagctaaaaatgatacgtggctgcaaatgcaagctgatattttcaatacgagg
gtaattaagttagaaaatgaacaagggccagctatgggggctgcaatgctggctgccttt
ggaagcggttggtttgaatcacttgaagaatgtgcagagcagttcattcgtgaggctgct
gcattttatccaaaggcgcaaaatgttcaaaaatataaaacactatttgatttgtataag
aacatttacactcacacaaaggatctcaatacagctttgaagagctttcgaaaaaactaa

DBGET integrated database retrieval system