KEGG   Bacillus subtilis subsp. subtilis 168: BSU17620Help
Entry
BSU17620          CDS       T00010                                 

Gene name
yncB
Definition
(RefSeq) endonuclease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNase CAC1F_C DUF4834
Motif
Other DBs
NCBI-GeneID: 939569
NCBI-ProteinID: NP_389644
Pasteur: BG12265
BSORF: BG12265
UniProt: P94492
Position
complement(1895378..1896013)
Genome map
AA seq 211 aa AA seqDB search
MKKILISMIAIVLSITLAACGSNHAAKNHSDSNGTEQVSQDTHSNEYNQTEQKAGTPHSK
NQKKLVNVTLDRAIDGDTIKVIYNGKKDTVRYLLVDTPETKKPNSCVQPYGEDASKRNKE
LVNSGKLQLEFDKGDRRDKYGRLLAYVYVDGKSVQETLLKEGLARVAYVYEPNTKYIDQF
RLDEQEAKSDKLSIWSKSGYVTNRGFNGCVK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattttgatcagtatgatcgcaatcgttttaagtattactttggcagcttgc
ggatcaaatcacgcagccaaaaaccattcagattctaatgggacggagcaagtctctcaa
gatactcactctaatgaatataatcagacagaacaaaaggctggcacgcctcattcaaaa
aatcagaagaaattggtcaatgttacattagatagagcaatagatggagatacgattaag
gttatttacaacggaaagaaagacacagttcgctacttgctcgttgatacacctgagacg
aagaaaccaaattcttgtgttcaaccatacggtgaggatgcgtcgaaacgaaataaagaa
ttggtcaacagcggtaagctacagctggaatttgataaaggcgatcgcagagataagtat
ggaagactgttagcatacgtttatgttgacggcaaatctgttcaagagacattattgaaa
gagggattggccagagtagcatatgtatatgagcctaacacaaaatacatagaccaattc
agactagatgagcaagaagcaaaatcagataaactgtcaatttggagtaagagcggttat
gtgacgaacagaggatttaatggctgtgtgaaatag

DBGET integrated database retrieval system