KEGG   Bacillus subtilis subsp. subtilis 168: BSU17630Help
Entry
BSU17630          CDS       T00010                                 

Gene name
yncC
Definition
(RefSeq) metabolite transport protein YncC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12 MFS_3
Motif
Other DBs
NCBI-GeneID: 939540
NCBI-ProteinID: NP_389645
Pasteur: BG12266
BSORF: BG12266
UniProt: P94493
Position
1896424..1897839
Genome map
AA seq 471 aa AA seqDB search
MDMNEHRNRRLKLIMISATFGGLLFGYDTGVINGALPFMARPDQLDLTPVTEGLVTSILL
LGAAFGALLCGRLADRYGRRKMILNLSFLFFLASLGTALAPNVFIMAVFRFLLGLAVGGA
SAMVPAFLAEMAPHEKRGRMVTQNELMIVGGQFLAYVFNAILGVTMANTGHVWRYMLVIC
AVPAIMLFASMLKVPESPRWLISKGKNSEALRVLKQIREDKRAEAECREIQEAVEKDTAL
EKASLKDFSTPWLRRLLWIGIGVAIVNQITGVNSIMYYGTQILKESGFGTKAALIANIGN
GLISVIAVIFGIWLVGKVRRRPILLIGLAGTTTALLLIAIFSIVLDGSMALPYVVLSLTV
LFLAFMQGCVGPVTWLVIAEIFPQRLRGLGSGISVFFLWILNFVIGFAFPILLSSVGLSF
TFFIFVALGVLAIGFVYKFMPETKGRTLEELEEHFRSRHDHNTPEQSVIEV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggatatgaatgaacatcgaaatcgaaggttgaaattaataatgatttcagcaactttt
ggagggcttctctttggatatgacaccggagttataaatggagctttaccttttatggca
aggccagatcagcttgatttaacacctgttacagaagggcttgttacgagtattctttta
ttaggtgccgcgtttggagcgttgttatgcggaagattggctgatcgatatggccgccgt
aaaatgatccttaatctttcctttttatttttcctggcatcactgggaacagcgttagca
cctaatgttttcatcatggcggtctttcgttttttactggggctggctgttggaggagcc
tcggcgatggtgccggcctttttagcagaaatggcaccgcatgaaaagagagggcgtatg
gtaacccaaaatgaactaatgattgttggcgggcaatttttagcatatgtttttaatgcg
atcctcggtgtaacaatggcaaatacgggacatgtttggagatacatgctagtcatttgt
gctgtaccggctatcatgttatttgccagtatgcttaaggtaccagaaagcccccgatgg
ctaatctccaaaggcaaaaacagtgaggcgctgcgagttcttaaacaaattcgagaagat
aaacgtgcagaagctgaatgtagagaaattcaagaagcggtagaaaaagatacagcacta
gaaaaggcatcactcaaggacttttctacaccatggctgcgccgtcttttatggattgga
atcggtgttgccatcgtgaatcaaattacaggtgtgaactcgattatgtattatggcaca
caaatccttaaagaatctggttttggtacaaaagcggctttaatcgctaatattggaaat
gggctgatatcagttattgcagttatatttgggatttggctggtcggaaaagtgagacgg
cgtccaatattattgattggtttggcagggacgactacagcgctcctattgattgcgatt
ttctcaattgtgcttgatggatctatggcacttccttatgtagtgctttctttgaccgtt
ttatttcttgcctttatgcaagggtgtgtaggacctgtgacttggcttgtcatagcggaa
atattccctcaaaggttaagaggacttggttctgggataagtgtttttttcctttggata
ttaaactttgtgatcggttttgctttcccgatcttgcttagctctgtaggtttgtctttt
acattctttatatttgtggctttaggtgtattggcaatcggttttgtgtacaaattcatg
ccggaaacaaaagggcgtacacttgaagaattagaagagcattttcgttctcgacacgat
cataatactcctgaacaatcagttattgaggtataa

DBGET integrated database retrieval system