KEGG   Bacillus subtilis subsp. subtilis 168: BSU17660Help
Entry
BSU17660          CDS       T00010                                 

Gene name
yncF
Definition
(RefSeq) deoxyuridine 5'-triphosphate nucleotidohydrolase YncF
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU17660 (yncF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU17660 (yncF)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     BSU17660 (yncF)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSU17660 (yncF)
 Prokaryotic type
    BSU17660 (yncF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dUTPase DCD PapG_N
Motif
Other DBs
NCBI-GeneID: 939541
NCBI-ProteinID: NP_389649
Pasteur: BG13437
BSORF: BG13437
UniProt: O31801
Structure
PDB: 

Position
1900080..1900514
Genome map
AA seq 144 aa AA seqDB search
MTMQIKIKYLDETQTRISKIEQGDWIDLRAAEDVTIKKDEFKLVPLGVAMELPEGYEAHV
VPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYALRDTEIKKGDRICQFRIMKKMP
AVELVEVEHLGNEDRGGLGSTGTK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgcaaattaaaatcaagtatctagatgaaacacaaacaagaatcagcaaaatt
gagcagggagactggattgatcttcgggcagctgaagatgtaacaatcaaaaaagatgaa
tttaagcttgtcccattaggtgttgcaatggagctgcctgaaggttacgaagcacatgtc
gtccctcgttcaagtacatataagaactttggcgttattcaaacaaattcaatgggtgtt
atcgatgagtcatataagggagacaacgatttctggttctttcctgcttatgcattgcgt
gatactgaaattaagaagggtgatcgtatctgccagtttagaatcatgaagaaaatgccg
gcggttgaattggttgaagtcgagcatttgggaaacgaggatagaggaggactcggttca
acaggtacgaagtaa

DBGET integrated database retrieval system