KEGG   Bacillus subtilis subsp. subtilis 168: BSU17690Help
Entry
BSU17690          CDS       T00010                                 

Gene name
yncM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YrpD
Motif
Other DBs
NCBI-GeneID: 939576
NCBI-ProteinID: NP_389652
Pasteur: BG13438
BSORF: BG13438
UniProt: O31803
Structure
PDB: 

Position
complement(1903511..1904263)
Genome map
AA seq 250 aa AA seqDB search
MAKPLSKGGILVKKVLIAGAVGTAVLFGTLSSGIPGLPAADAQVAKAASELPNGIGGRVY
LNSTGAVFTAKIVLPETVKNNDSVSTPYIYSGFRATSGTEADIGLQYSKQYNVWKPLMKV
GSKNEETYIEGKDKFTYNKGFRPGSTVQMTIYKNLSGNTRMTLWGTNNDGYTGRIITEIQ
GTNIGTISKWKTLATAAVSYESQRDAIKATFSTSFNNITIDNKAVTPVVDTQDFAKVSVA
GNNVTISVNK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaccactatcaaaagggggaattttggtgaaaaaagtattgattgcaggtgca
gtaggaacagcagttcttttcggaaccctttcatcaggtataccaggtttacccgcggca
gacgctcaagtcgcaaaagcagcatccgagctgcctaacggaatcggcggccgtgtctac
ctgaacagtacgggcgccgtttttacagctaaaatcgtgcttcctgaaactgtcaaaaac
aacgactcggtctctactccctatatttattctggctttagggcaacaagcggaactgaa
gccgatatcgggcttcagtacagcaaacaatacaacgtctggaagcccctcatgaaggtt
gggtccaaaaatgaagaaacgtacatcgaaggaaaagacaaattcacatacaataaaggc
ttccgccctggaagcacagtccaaatgacaatctataaaaatttaagcggcaatacgcgc
atgaccctttggggaacgaacaatgacggctacaccggacggattatcacagaaattcaa
ggaaccaacatcggcacgatttcaaaatggaaaacacttgctaccgcggctgtttcgtat
gaaagccagcgtgatgcgatcaaagcaaccttttcgacctcttttaacaacatcactatc
gacaataaagccgtcactcctgtggtagatacacaggatttcgcaaaggtttcagttgca
ggaaataacgttacgatctctgttaataaataa

DBGET integrated database retrieval system