KEGG   Bacillus subtilis subsp. subtilis 168: BSU17710Help
Entry
BSU17710          CDS       T00010                                 

Gene name
tatAC
Definition
(RefSeq) Sec-independent protein translocase protein TatAc
  KO
K03116  sec-independent protein translocase protein TatA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
bsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU17710 (tatAC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU17710 (tatAC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU17710 (tatAC)
Secretion system [BR:bsu02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   BSU17710 (tatAC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MttA_Hcf106
Motif
Other DBs
NCBI-GeneID: 939527
NCBI-ProteinID: NP_389654
Pasteur: BG13464
BSORF: BG13464
UniProt: O31804
Position
complement(1905370..1905558)
Genome map
AA seq 62 aa AA seqDB search
MELSFTKILVILFVGFLVFGPDKLPALGRAAGKALSEFKQATSGLTQDIRKNDSENKEDK
QM
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atggaattaagcttcacaaaaatactcgttattttgtttgtgggttttttagtatttggg
cctgataaactgccggcgcttggccgtgcagcaggaaaagccttatcagaatttaaacaa
gcaacaagcggactgactcaggatatcagaaaaaatgactcagaaaacaaagaagacaaa
caaatgtag

DBGET integrated database retrieval system