KEGG   Bacillus subtilis subsp. subtilis 168: BSU17720Help
Entry
BSU17720          CDS       T00010                                 

Gene name
yndA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939521
NCBI-ProteinID: NP_389655
Pasteur: BG13439
BSORF: BG13439
UniProt: O31805
Position
1905809..1906207
Genome map
AA seq 132 aa AA seqDB search
MRFTKVVGFLSVLGLAAVFPLTAQAEKAGTAGAGEWDKLGTYTYTYSSPTVYSTGGDFRV
CLSGSTPFSVSLHLYEDDPGDNPDDYVGANYFSPGECHTFGSIGKFVDGSNNKAEFFVTD
YSGKSKTVTFYD
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagattcactaaggtagttggatttttgtctgttttagggttggctgcggtttttcca
ttaacggcacaagcagaaaaagccggaactgcgggggctggagagtgggataagttgggg
acttacacatatacttactcaagtccgacggtatactcgaccggaggagattttagagtg
tgcctttcaggaagcactcctttttctgtttcactgcacttatatgaggatgatcccggt
gacaatcctgatgattatgtaggggcaaactatttttcacccggagaatgccacaccttt
ggcagtattggaaaatttgtagatgggagcaataacaaggccgagttctttgttaccgat
tactctggtaaatctaaaactgttacgttttatgattga

DBGET integrated database retrieval system