KEGG   Bacillus subtilis subsp. subtilis 168: BSU17740
Entry
BSU17740          CDS       T00010                                 
Symbol
ynzB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939516
NCBI-ProteinID: NP_389657
Pasteur: BG13465
BSORF: BG13465
UniProt: O31807 A0A6M4JGR7
Position
1907013..1907201
AA seq 62 aa
MLGKIKAAIDNSPGKPARILVSEKAFQQLEEEMRFVYVSKPKTIMGIPVEVSDQAESFKL
EF
NT seq 189 nt   +upstreamnt  +downstreamnt
atgcttggaaaaatcaaagcagccattgataatagtccagggaagccggccagaatttta
gttagtgaaaaagcgtttcagcaattagaggaagaaatgcgctttgtttacgtttccaaa
ccgaaaacgataatggggattcctgtggaagtttcagatcaggcagaaagcttcaagctg
gaattttag

DBGET integrated database retrieval system