KEGG   Bacillus subtilis subsp. subtilis 168: BSU17740Help
Entry
BSU17740          CDS       T00010                                 

Gene name
ynzB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939516
NCBI-ProteinID: NP_389657
Pasteur: BG13465
BSORF: BG13465
UniProt: O31807
Position
1907013..1907201
Genome map
AA seq 62 aa AA seqDB search
MLGKIKAAIDNSPGKPARILVSEKAFQQLEEEMRFVYVSKPKTIMGIPVEVSDQAESFKL
EF
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgcttggaaaaatcaaagcagccattgataatagtccagggaagccggccagaatttta
gttagtgaaaaagcgtttcagcaattagaggaagaaatgcgctttgtttacgtttccaaa
ccgaaaacgataatggggattcctgtggaagtttcagatcaggcagaaagcttcaagctg
gaattttag

DBGET integrated database retrieval system