KEGG   Bacillus subtilis subsp. subtilis 168: BSU17750Help
Entry
BSU17750          CDS       T00010                                 

Gene name
yndD
Definition
(RefSeq) hypothetical protein
  KO
K06310  spore germination protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU17750 (yndD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerA
Motif
Other DBs
NCBI-GeneID: 939529
NCBI-ProteinID: NP_389658
Pasteur: BG13441
BSORF: BG13441
UniProt: O31808
Position
1907494..1909056
Genome map
AA seq 520 aa AA seqDB search
MMRWRNNQYKTQKQHKSDYSTAEKQDQDVLTGNIGYDLEHVKRKIGHNGDVHFRELEITQ
LHVKAALIFVEGLSDQDLINKGLSVLVMNQPNQVSDEISQSGKGILTSKQIKNQIVSIGD
VIDSEKISDIVLNVFMGSTALLIDGIPQAFLLGTVKKQNRSIEEPLSEALVRGPRTGFTE
ELSTNTALLRQQGKNDQLTLQRFEVGTRLKKDLIIAYMNDIADPKVVEEVRKRVRGIEID
HLPESGYVEQLIEDNYLSPFPQVQSTERPDRVISGLMEGRVAILLDGTPFALIVPVTFSM
MLQSPEDYYERWFPSSLIRLLRFIAAMITLFAPALYISFISFHPGLIPTKLAISISGTRQ
GVPFPSLIEALFMEVAIEILREAGLRLPKPIGPAIGIVGGLIIGEAAVQAGIVSPIMVIV
VALTAISSFAIPHYSTGIALRMLRFGAMFCAAVFGLFGVIMYYLLLSSHVVKLKSFGVPY
ASPAVPYHLKDWKDFVIRMPLLVMKRRPKMMNTDNTKRVK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtggcggaacaatcagtacaaaacacagaagcagcataaatcagattattcg
acagctgaaaagcaggatcaggatgtgttaaccggtaacatcggatacgacttagaacat
gtaaaaagaaaaataggacataacggggacgttcatttccgtgagcttgaaatcactcaa
ttacatgtgaaagcggcattgatctttgttgaaggactgtctgatcaggacttgattaat
aaaggactatcagtgttagtcatgaatcaacctaatcaggtaagcgatgaaatttctcaa
tccggcaaaggtattttaacttcgaaacagataaaaaatcaaatcgtatcaatcggtgat
gtcatagattcagagaaaatcagtgatatcgtgttgaatgttttcatgggttcgacagcg
cttctcatcgatggaataccgcaggcctttcttctgggaactgtaaaaaaacaaaatcga
agtatcgaggagccgctttcagaagcgcttgtcagagggccgcgcacaggctttacagaa
gagttgagtacgaatacagctcttttgagacagcaaggaaaaaatgatcaattaacattg
cagagatttgaagtaggaacacgattaaaaaaggatttaattatcgcttatatgaatgac
attgcagatccaaaagtagtcgaggaagtaagaaaaagagtgagagggattgagatcgat
catttgccggagtcaggctacgttgaacagttaattgaggataattatttgagcccgttc
ccgcaagtacagagtacagaacgtcctgatcgcgtcataagcggattaatggaaggaaga
gtagctattctgcttgacggcactccgtttgctttgattgttccagtcactttcagcatg
atgcttcaatcgcctgaagattattatgaacggtggttcccgagctcgctcatcagattg
ctgaggttcatcgcagcaatgataacgttattcgcacccgctttatatatatcatttatt
tcttttcatcctgggttaattccgaccaagctggcgatttcaatttccgggacgcgccaa
ggtgttccgttcccatctctgattgaagccttatttatggaagtcgcgattgaaatttta
agagaggcggggcttcgtttgccaaaaccaattggacccgcaataggcatagttggcgga
ttaatcatcggggaagcagctgtgcaggcggggattgtcagtccaatcatggtcattgtt
gttgcgctcacagcaatttcttcatttgccatcccgcattatagcacaggtatagcactt
cggatgcttcggtttggcgcgatgttttgtgcggcggtgtttggattgtttggagtcatt
atgtattatctgctgctaagcagccatgtcgtaaagctaaagagctttggtgtgccatac
gcaagtccggcagtgccctatcacttaaaagattggaaagactttgttatcagaatgcct
cttttagtcatgaagcgccggcctaaaatgatgaatacagataatacaaaacgggtgaag
tga

DBGET integrated database retrieval system