KEGG   Bacillus subtilis subsp. subtilis 168: BSU17760
Entry
BSU17760          CDS       T00010                                 

Symbol
yndE
Name
(RefSeq) spore germination protein YndE
  KO
K06311  spore germination protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU17760 (yndE)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU17760 (yndE)
SSDB
Motif
Pfam: Spore_permease
Other DBs
NCBI-GeneID: 936538
NCBI-ProteinID: NP_389659
Pasteur: BG13442
BSORF: BG13442
UniProt: O31809 A0A6M3ZBH4
Position
1909086..1910177
AA seq 363 aa
MFSPTSKITTAQATIIIINYMLAAGVLTLPRTVTEQTQSPDGWISVLLGGVLAVIAGMII
AKLSQQYPKETFYEYSRHIVGKWLGHLISIVFITYFLALGAFEVRVMSEIVDFFLLEGTP
SWAIIMTVLWIGLYSITQGLDPIARLFEMIFPITVIIFLTIALMSLGIFEINNLRPVLGD
GIMPVLRGVKTTNLSFTCSEIMFILVAFMKKPKNAVKAVVIGTGVVTSFYMITMIMVIGA
LSVEGVVTRTWPGLDLMRSFEIPGLIFERFESFLLVIWIMQLFATFIITFYAASLGVSQV
FKKKPLSCMFGLLPVIYILSCMPKNENDVFILGDTVSHIALYIFGALPILLLVISKWRKR
GEK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgttcagcccaaccagtaaaatcacaaccgctcaggcaacgattatcatcattaattat
atgcttgctgccggagttcttacgctccctcggacagtaacagaacaaacacaatctcct
gatggatggatttcagttttattaggcggggtcctagcggtaatagccgggatgattata
gctaaattaagccagcagtatcctaaggagaccttttatgaatactcccgacatattgta
ggaaaatggctcgggcatctgatcagtattgtttttattacttattttctggcactcggt
gcatttgaagtcagagtcatgtccgaaatcgtggatttttttctcctcgaagggacacct
tcttgggccatcattatgacagttctttggattgggctttattcaattacacaaggccta
gatccgattgcacggctttttgaaatgatttttccgattacggtcatcatctttttaacg
atagccctcatgagtttaggcatatttgagatcaacaatttgcgccctgtattaggtgat
ggaatcatgccggttcttagaggtgtaaagacaacgaacctttcatttacatgttcagaa
attatgttcattttagtagcatttatgaaaaagccgaaaaatgcggtgaaagcagttgtg
atcgggacaggcgttgtgaccagtttttatatgattacgatgattatggtcatcggtgca
ctatcagttgagggagttgtgacgagaacatggccggggcttgacctgatgagaagtttt
gaaatacctggtttaatatttgaacggtttgaatcatttctgcttgtgatttggattatg
cagctttttgccacgtttattatcactttttatgcagcttccctgggagtctcacaagtt
tttaaaaagaaacccctttcatgtatgtttgggctgcttcctgttatatatatcctctct
tgcatgccgaaaaatgaaaatgacgtctttatattgggcgatacggtcagtcatatcgct
ttgtatatatttggcgctttgccgattttgctgttagtcatttcgaaatggaggaaaaga
ggtgaaaagtaa

DBGET integrated database retrieval system