KEGG   Bacillus subtilis subsp. subtilis 168: BSU17770Help
Entry
BSU17770          CDS       T00010                                 

Gene name
yndF
Definition
(RefSeq) spore germination protein YndF
  KO
K06312  spore germination protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU17770 (yndF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_GerAC DUF2884 CDC37_M
Motif
Other DBs
NCBI-GeneID: 939547
NCBI-ProteinID: NP_389660
Pasteur: BG13443
BSORF: BG13443
UniProt: O31810
Position
1910167..1911381
Genome map
AA seq 404 aa AA seqDB search
MKSKLKRQLPAMVIVCLLMICVTGCWSSREIEDLGLTFAIAIDKGKETNTEKELKEEGGS
YPKKDNITLTYQFVNEKAAGAGTSGGGGSGQGAQKAYINISETGDSLQQIGSEVALRRDR
EVFSPHLKVVVMSEDVLHTFPIDEMLDQFFRDNEIRLSCLVLSAKGEARDALQLKENGEI
PAFRLIGLGENEHKVSRILPPMTLAKLIGKLHSGSSFLLQNVVAANGAVKYSGAAVINGK
SKKMIGTLNEYETEGITWIRGEGKGGVVKSHDKKSQQTLAYDINKIKSRIQPIVKGKDIS
FHVDIESEGDLVENWNTKEALDTQFIDRLETTIENEVKKIVGQVLKKIQHDYKADVAGFD
ESFRLTYPHLWKRVKNNWDDTFSKADITYSVNVTITHFGTVKTQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtaaactaaaacgtcaattgcctgctatggtcatagtatgtctgctgatgatt
tgcgtaacaggatgctggagcagtcgggaaatagaagatctgggtctcacattcgctatc
gcaattgataaaggaaaagaaacgaacactgaaaaagagttaaaagaagagggcgggagc
tatccgaaaaaagacaacattacgctgacctatcaatttgttaatgaaaaagcggcaggc
gcgggcacaagcgggggaggcggtagcggacaaggagcgcaaaaagcgtacattaatata
agtgaaacaggggattcattacagcagatcggaagtgaggttgcattaagacgggaccga
gaagtgtttagcccgcatttaaaagttgttgtcatgagtgaagatgtgctgcacacattt
cctatcgacgaaatgctggatcaattttttcgtgataatgaaatcaggctgagctgtctt
gttttatctgctaaaggggaagcaagagacgctctccagctgaaagagaacggagaaatt
ccggcatttcggctgattggattaggtgaaaatgaacataaagtttccagaattcttccc
cctatgacactcgcgaaactaattggaaaactgcattctggcagcagctttttactgcaa
aatgtggttgcggcgaatggagcggtcaagtattccggagcagctgtaatcaacggaaaa
tcgaaaaaaatgataggcaccttaaatgaatatgaaactgaggggattacatggattaga
ggagaagggaaaggcggagttgtcaaaagtcatgataaaaagagccaacagacgttagcg
tacgatatcaataaaatcaaaagcagaattcagccaatcgtaaaagggaaagatatttca
ttccatgtcgatattgaatcagaaggcgatttggttgaaaactggaacacaaaagaggcg
ttggacacccagtttatagatcgtctcgaaacgactattgaaaacgaggtaaagaaaata
gttggtcaggtattaaaaaaaattcagcatgattataaagcagatgttgcgggttttgat
gaatcttttagacttacatatcctcacttatggaaaagggtgaaaaataactgggatgac
accttcagtaaagccgacatcacatacagtgtgaacgtcacaattactcatttcggcacg
gttaaaactcagtaa

DBGET integrated database retrieval system