KEGG   Bacillus subtilis subsp. subtilis 168: BSU17780Help
Entry
BSU17780          CDS       T00010                                 

Gene name
yndG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939565
NCBI-ProteinID: NP_389661
Pasteur: BG13444
BSORF: BG13444
UniProt: O31811
Position
1911528..1912334
Genome map
AA seq 268 aa AA seqDB search
MRQKPIYVEIEMKSDLDTLWEYTQNPSLHKEWDLRFSNITYLNSQPCEKQKFLYETRVGF
GLKVSGTGETVGVFNKCSSERSSSLAFGSDHPLSLIRHGSGYWKYIQRENGKMTFLTQYQ
YKTAYGLLGRWIDRLLFRPLLGWATAWSFDALRLWVEQNKHPKRFIRSAIIYVFMCLFFS
LFWFYQGFAGVKTSILTGTAEIGLAILWLLPLKRKWIIHGVQACIFAGFACLGSEIFMWV
LLSVFSAASGALSLQLPSARRTKRKRKK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcagaaaccgatttatgtagaaatcgaaatgaaatctgatctggatacactctgg
gaatatacacaaaacccatcactgcataaggaatgggatctccggttttcaaatattacg
tatttgaatagtcagccatgcgaaaaacagaagtttctttacgaaacaagggtaggcttt
ggattaaaggtgtcaggtacaggagaaaccgtcggtgttttcaacaaatgttcatctgaa
aggtcttcttcactggcttttggctctgatcatccattatctctgattcggcatggaagc
ggctactggaagtatatacagagagaaaatgggaaaatgacgtttttaacacagtaccaa
tacaaaacagcctacggactgctgggaagatggattgatcgtttattatttcggccgctg
cttggctgggcgactgcctggagctttgatgcattaaggctttgggtagagcaaaataaa
catccgaagcgcttcattcgatctgctatcatctatgtgttcatgtgtctgtttttcagc
ctgttttggttctatcaaggctttgcaggtgttaagacaagcatattgacaggaacagcg
gagataggcttagctattttgtggctgcttcctttaaaaagaaaatggatcattcatggt
gtccaggcttgtatttttgctgggtttgcttgtctaggttccgaaatattcatgtgggtt
ctattgagtgtgttttccgctgcaagcggcgctcttagcctgcagctccccagtgccagg
cgcacaaaacgaaagagaaagaagtga

DBGET integrated database retrieval system