KEGG   Bacillus subtilis subsp. subtilis 168: BSU17800Help
Entry
BSU17800          CDS       T00010                                 

Gene name
yndJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YndJ
Motif
Other DBs
NCBI-GeneID: 939575
NCBI-ProteinID: NP_389663
Pasteur: BG13446
BSORF: BG13446
UniProt: O31813
Position
1912953..1914593
Genome map
AA seq 546 aa AA seqDB search
MKRNGIVSALCFIGFLAAEAPDISVAEALVLLSILFFVPGIFPFVFRQSPVRAAQFMENG
LIQCYPVAAFFAVLALVTEVGGFALIWWMYTVFNALYAILRLWETKIHRIEETSVLFGLI
YLAGGGFWFFAYAAHLQIMQFGPLIILLTAVHFHYSAFLIPIFNGLLGRTIRKHRMLYSW
ITWVILLSPLLIALGITYSKTLDVIAVSIYMAAIYLHAFLVFTAAFRTKTGTFLIRLSSA
VLMITIAFSMIYSFGVFRQEVTLTINQMIWIHGFVNAFGVILPALIGWRIEDAKPFDADS
VKTFSRIYGKRKIGEEFLANIQAENNARYSGLVDDMGSLRSKDFSPEKLAPLILSFYEQT
IEYNIKAKVTWSTWFRPLAIIYEWFSRRIGQIHLSTNPDWYRMYSKIKGVHSKKDGRERV
RAWIRTNEKNETIFTALYSVYRSNGEGYMNISLPLPFSSMTGILKPYHHQEKLVLTSRRR
KSRAGDEGIYLQTRAGTCPLPLSETFLIEAVHDNKLTAVHHMWLFGIKFLTVHYSITHIN
QPIERT
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaatggcatagtcagtgcgctttgttttattggatttcttgcagcagaagca
ccggatatttcagtggcagaggcactcgttttgttatccattctatttttcgtgccggga
atttttccttttgtttttcgtcaatctccggttcgtgctgctcagtttatggaaaacggg
ctaatccagtgctatcctgtagccgcattctttgcggtgctggctctagtgacggaggtt
gggggtttcgcacttatctggtggatgtacacagtttttaatgcattgtatgcgatcctc
cgcctttgggaaacaaagatacatagaatcgaagagacatcagttttgttcggtcttatt
tatttggcgggaggaggattttggttttttgcttatgctgcccatttgcagatcatgcaa
tttggccctctcatcattttgctgactgctgtccactttcactattctgcttttctgatc
ccgatcttcaacggtttactcggcagaaccattagaaaacatcggatgttgtacagttgg
ataacatgggtgattttgctttcgccccttcttatcgcactgggcatcacatattcaaaa
acacttgatgtcattgcggttagcatttatatggcggcgatttatcttcatgcatttttg
gtgttcacggcagcttttcgcaccaagacggggacatttcttattcggctttcttccgct
gttttaatgataacgattgctttctcgatgatttattcatttggtgtctttcggcaagaa
gttacattgaccatcaatcagatgatttggattcacggttttgtcaacgcgtttggtgtt
atcttgcccgctctcatagggtggagaatagaggatgcgaaaccttttgatgcagacagt
gtaaagacattcagccgtatctacggaaaaagaaagattggagaagaatttttagctaac
attcaagctgaaaataacgctcggtacagcggacttgtggatgatatgggcagcctgcgt
tcaaaagatttttcaccagaaaaactggcgccgctcattctttcgttttatgaacaaacc
atcgaatacaatattaaagcaaaagtaacatggagcacgtggtttcggccgcttgcaatt
atttacgaatggttcagcagaagaatcggccaaatacatctttcgacgaaccctgactgg
tataggatgtacagcaagataaaaggtgttcattcgaaaaaagacggaagggaaagagta
cgtgcctggattagaacaaatgaaaaaaacgaaaccatttttaccgctctttattcagtg
tatcgttcaaatggagaggggtatatgaatatttctttaccgcttccattcagcagcatg
acaggtattttaaaaccatatcatcatcaggagaagctggttttaacaagcaggcggaga
aaaagcagagcgggggatgaggggatttatctgcaaacaagagcgggaacttgtccgctt
cctttatctgaaacctttctgatagaagctgtacatgacaacaaattaaccgctgttcat
catatgtggctgtttggaataaaatttctaactgttcattacagcattacacatattaac
cagcctattgaaagaacctaa

DBGET integrated database retrieval system