KEGG   Bacillus subtilis subsp. subtilis 168: BSU17810
Entry
BSU17810          CDS       T00010                                 

Symbol
yndK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: INSIG
Other DBs
NCBI-GeneID: 936932
NCBI-ProteinID: NP_389664
Pasteur: BG13447
BSORF: BG13447
UniProt: O31814
Position
1914630..1914995
AA seq 121 aa
MNCFKILHRIKTGKEGFMVFYISLFLILWLAAGFAVGMKQVYVDQLFDKAVIERLEKEAN
DHGHADRMIKQRVLYIAAVTVSGFISVYYEMKTIPQRRNIRKIEKNIMKLNQAKKRRMKR
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaactgttttaaaattctgcaccgcatcaagacaggaaaggaagggtttatggtgttt
tatatcagtttatttctgattctttggctggctgctgggtttgcagtgggaatgaaacaa
gtgtatgtcgatcagctgtttgataaagctgtgatcgaaagactggaaaaagaagcgaat
gatcatggacatgctgaccggatgatcaaacagcgcgtcctttatattgcagcagtgaca
gtaagcgggtttatttctgtttattatgaaatgaaaacaatcccgcaaaggcgaaacata
agaaaaattgaaaaaaacatcatgaaattaaatcaagcaaaaaaacgaagaatgaagaga
aaataa

DBGET integrated database retrieval system