KEGG   Bacillus subtilis subsp. subtilis 168: BSU17820Help
Entry
BSU17820          CDS       T00010                                 

Gene name
yndL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gamma_PGA_hydro FMN_dh
Motif
Other DBs
NCBI-GeneID: 939553
NCBI-ProteinID: NP_389665
Pasteur: BG13448
BSORF: BG13448
UniProt: O31815
Structure
PDB: 

Position
1915221..1915979
Genome map
AA seq 252 aa AA seqDB search
MKPAKVSLLRRLLHSLKHVDCNIAKRFPSTIKIVKLLMIFMVFTPISSIYAEDVYQNFEE
LKNNEDPSDYGVVTKETGSPVLVLAIHGGGIEGGTSEVARELSKEYSMYLFEGLKSAGNS
VLHITSTHFDEPRALKMTGNHEYVISLHGYAEEDQQIEVGGTDRVRAADLVEKLQHAGFP
AVLLNMDHPHAGVSPNNIANKSKTGLSIQIEMSTGFRKSLFGIFSLKSRAVTQNERFYEF
TEVMFRFLKNSY
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggccaaagtatccctgctccgccgtttgctccattccttgaagcatgttgat
tgtaacatagccaaacgttttccatcaactattaaaattgtaaaattattgatgattttt
atggtgtttactccgatttcttcaatttatgctgaagatgtatatcagaattttgaggaa
ttaaaaaacaatgaagatccttctgattatggcgttgttacgaaagaaaccggaagccct
gttcttgttttagctattcacggaggaggtattgaaggcgggacaagtgaagtagcgaga
gagctcagcaaagagtactcgatgtatttatttgaaggcttaaaatcggcaggaaactca
gtcctgcacattacgagcacacactttgatgaacctcgggcccttaaaatgacgggaaat
catgaatatgtcatttcattacacgggtacgcagaagaagatcagcagatcgaagtcggc
ggtacagatcgcgtaagagcggcagatttagttgagaaattgcagcatgccggttttcct
gctgtattgctcaatatggaccatccgcatgcgggcgttagtccgaataacattgcaaat
aaatcaaaaacaggtttaagtattcagatagaaatgagcacagggtttcgaaagtctttg
ttcggcatcttttctttaaaaagcagagctgttactcaaaatgagaggttttatgagttt
acagaagtgatgttccgttttctcaaaaatagctactga

DBGET integrated database retrieval system