KEGG   Bacillus subtilis subsp. subtilis 168: BSU17830Help
Entry
BSU17830          CDS       T00010                                 

Gene name
yndM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2512 Phage_holin_4_2 GtrA
Motif
Other DBs
NCBI-GeneID: 938236
NCBI-ProteinID: NP_389666
Pasteur: BG13449
BSORF: BG13449
UniProt: O31816
Position
complement(1916006..1916545)
Genome map
AA seq 179 aa AA seqDB search
MTIMNGFELHYLSFVYAQEFSSKNNNLGGQMKHIIALASKIAFTLALLYVILDRVYHASF
LSVMFIALFLGFVSYLSGDMLVLPRTNNITASLADFGLSFVILWVFVLTQTRNDFSPFGA
ALLSAACLTVFEYFFHRYLLKNVLDENFRNELSARDNTLQYQTEAADELFPETKEKHKE
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaccattatgaatggttttgaattgcattatttatcatttgtttacgcccaagaattt
tcttcaaaaaataacaatttaggtggtcaaatgaaacatatcattgcgcttgcttcaaag
attgctttcactctcgcccttttatatgtgattttggacagagtctatcacgcatccttt
ttaagtgtgatgtttattgcacttttcttaggttttgtttcctatctttctggtgacatg
ctcgtcttacccagaacaaacaatattacagcttcattggctgactttggcctttcattc
gttattctttgggtatttgttttaacccaaacaagaaacgatttctcaccatttggagcg
gctctcctttccgctgcctgtcttactgtttttgaatacttttttcatcggtatttactg
aaaaatgtgcttgatgaaaatttccgaaatgaactgtcagcgagagataacacgttgcag
tatcaaacggaagccgcggacgagctgtttcccgaaacgaaagagaagcataaggaatag

DBGET integrated database retrieval system