KEGG   Bacillus subtilis subsp. subtilis 168: BSU17840Help
Entry
BSU17840          CDS       T00010                                 

Gene name
yndN
Definition
(RefSeq) metallothiol transferase FosB
  KO
K11210  metallothiol transferase [EC:2.5.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU17840 (yndN)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.-  
     BSU17840 (yndN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_2 Glyoxalase_6
Motif
Other DBs
NCBI-GeneID: 938817
NCBI-ProteinID: NP_389667
Pasteur: BG13450
BSORF: BG13450
UniProt: O31817
Position
1916663..1917097
Genome map
AA seq 144 aa AA seqDB search
MEIKGINHLLFSVSHLDTSIDFYQKVFGAKLLVKGRTTAYFDMNGIWLALNEEPDIPRND
IKLSYTHIAFTIEDHEFEEMSAKLKRLHVNILPGRERDERDRKSIYFTDPDGHKFEFHTG
TLQDRLRYYKQEKTHMHFYDETAF
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
gtggagataaaaggaatcaatcacttgctattttcagtttcgcatttggatacatcgatt
gatttttatcaaaaagtgtttggtgcaaagcttttggtaaagggaagaacaactgcatat
tttgatatgaacggcatctggctagcgcttaatgaagaaccagacatcccgagaaatgac
attaagctttcttatacccatattgcttttacaattgaagatcatgaatttgaggagatg
tcagctaaattaaaaagacttcatgtcaatattctgcctggcagagaacgagatgaacgc
gatcgaaaatcaatttattttaccgaccctgacggccacaaatttgaatttcataccgga
acccttcaagacaggcttcgatattacaaacaagaaaaaacgcatatgcacttttatgat
gaaacggccttttga

DBGET integrated database retrieval system