KEGG   Bacillus subtilis subsp. subtilis 168: BSU17850Help
Entry
BSU17850          CDS       T00010                                 

Gene name
lexA
Definition
(RefSeq) lexa repressor
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU17850 (lexA)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU17850 (lexA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     BSU17850 (lexA)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S24: LexA family
   BSU17850 (lexA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    BSU17850 (lexA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LexA_DNA_bind Peptidase_S24 HTH_IclR MarR_2 HTH_24 MarR HTH_Crp_2 TrmB HTH_11 HTH_20 HTH_28 KfrA_N HTH_5
Motif
Other DBs
NCBI-GeneID: 939564
NCBI-ProteinID: NP_389668
Pasteur: BG10678
BSORF: BG10678
UniProt: P31080
Position
complement(1917639..1918256)
Genome map
AA seq 205 aa AA seqDB search
MTKLSKRQLDILRFIKAEVKSKGYPPSVREIGEAVGLASSSTVHGHLARLETKGLIRRDP
TKPRAIEILDEEVDIPQSQVVNVPVIGKVTAGSPITAVENIEEYFPLPDRMVPPDEHVFM
LEIMGDSMIDAGILDKDYVIVKQQNTANNGEIVVAMTEDDEATVKRFYKEDTHIRLQPEN
PTMEPIILQNVSILGKVIGVFRTVH
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagctatcaaaaaggcaacttgatatcctccgttttattaaagcagaggttaaa
tcaaaaggatatccgccttccgtgagagagatcggagaggctgtcgggcttgcgtccagt
tctactgtccacggccatttggcccgtttggaaacaaaagggctgatcagacgagatccg
acaaaaccaagagcaatagaaattcttgatgaagaagtagacattccgcaaagccaggtc
gttaatgtaccggtcatcgggaaagtcacggcgggatctcctattacagcagtagaaaat
attgaagaatattttccgctccctgaccgcatggttcctccagacgagcatgtatttatg
ctggagattatgggagacagtatgatagatgctggtattctcgataaggactatgtcatc
gttaaacagcaaaacacagcgaacaatggggaaattgtagttgcgatgacagaagatgat
gaagcaactgtaaaacgattctataaagaggatacccacattcgcttgcagcctgagaac
ccaacgatggaacctatcattttgcagaatgtcagcattctagggaaagtgattggcgtg
ttcagaaccgtccattaa

DBGET integrated database retrieval system