KEGG   Bacillus subtilis subsp. subtilis 168: BSU17890Help
Entry
BSU17890          CDS       T00010                                 

Gene name
tkt
Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU17890 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    BSU17890 (tkt)
Enzymes [BR:bsu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     BSU17890 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 937377
NCBI-ProteinID: NP_389672
Pasteur: BG11247
BSORF: BG11247
UniProt: P45694
Position
1919861..1921864
Genome map
AA seq 667 aa AA seqDB search
MDTIEKKSVATIRTLSIDAIEKANSGHPGMPMGAAPMAYTLWTKFMNVSPANPGWFNRDR
FVLSAGHGSALLYSMLHLSGFDLSIEDLKGFRQWGSKTPGHPEFGHTAGVDATTGPLGQG
IAMAVGMAIAERHLAETYNRDSFNVVDHYTYSICGDGDLMEGISSEAASLAGHLQLGRLI
VLYDSNDISLDGDLDRSFSENVKQRFEAMNWEVLYVEDGNNIEELTAAIEKARQNEKKPT
LIEVKTTIGFGSPNRAGTSGVHGAPLGKEESKLTKEAYAWTYEEDFYVPSEVYEHFAVAV
KESGEKKEQEWNAQFAKYKEVYPELAEQLELAIKGELPKDWDQEVPVYEKGSSLASRASS
GEVLNGLAKKIPFFVGGSADLAGSNKTTIKNAGDFTAVDYSGKNFWFGVREFAMGAALNG
MALHGGLRVFGGTFFVFSDYLRPAIRLAALMGLPVTYVFTHDSIAVGEDGPTHEPVEQLA
SLRAMPNLSLIRPADGNETAAAWKLAVQSTDHPTALVLTRQNLPTIDQTSEEALAGVEKG
AYVVSKSKNETPDALLIASGSEVGLAIEAQAELAKENIDVSVVSMPSMDRFEKQSDEYKN
EVLPADVKKRLAIEMGSSFGWGKYTGLEGDVLGIDRFGASAPGETIINEYGFSVPNVVNR
VKALINK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggatacaattgaaaagaaatcagttgctaccattcgcacactgtcaatagacgctatt
gaaaaagcaaattctggtcacccagggatgccgatgggagccgctccaatggcatacacg
ctgtggacaaaatttatgaacgtaagtccggcaaaccctggctggtttaaccgtgaccgt
tttgttttatctgctggacacgggtcagcactattatacagcatgcttcatttaagcggg
tttgatcttagtattgaagatcttaagggattccgccagtggggcagcaaaacaccagga
catccggaattcggacatactgccggtgttgatgctacaacaggtccgcttggccaagga
attgccatggcagtcggtatggcaattgctgaacgccatttagcggaaacatacaaccgc
gattcatttaacgtagtcgatcattatacatacagtatttgcggtgatggtgatttaatg
gaaggtatttcttctgaagccgcttcactcgcaggccatcttcagcttggccgtctgatc
gtactatacgattctaatgacatctctcttgatggagacctcgaccgttcattctctgaa
aacgtgaaacagcgttttgaagcaatgaattgggaagttctttatgttgaggatggaaac
aatattgaagaattaacagcggctatcgaaaaagcacgccaaaatgaaaagaaacctaca
ttaattgaagtgaaaacgacaatcggattcggttcacctaaccgtgccggtacatccggt
gttcacggtgcgccgcttggtaaagaagaaagcaaattaacaaaagaagcttacgcgtgg
acatatgaagaagacttctacgttccgtcagaagtttatgagcatttcgctgtagctgtt
aaagaatcaggtgagaaaaaagaacaagaatggaatgctcaattcgctaaatataaagaa
gtttatcctgaacttgctgaacagcttgaactggcaatcaaaggagagcttccgaaggac
tgggatcaagaggttcctgtgtatgaaaaaggaagcagtttggcatcccgtgcatcttcc
ggtgaagttctcaacggacttgcgaaaaaaattcctttctttgtcggaggttctgctgac
ctagcgggatcgaacaaaacgactattaaaaatgccggtgattttacagcggttgattac
tcaggcaaaaacttctggtttggtgtacgtgaatttgcgatgggtgcggccttaaacggt
atggcgcttcatggcggtcttcgtgtattcggcggaactttctttgtcttctctgattac
ctgcgtcctgcgattcgccttgcagcgttaatgggccttcctgtgacatatgtcttcaca
catgacagtattgcggttggtgaagacggtccgacgcacgagcctgttgaacagcttgct
tcactccgtgcgatgcctaacctttctttgatccgtccagcagacggcaatgagacagca
gcagcatggaagcttgcagtgcaaagcactgaccacccaacagcgctagtgcttacacgt
caaaaccttcctaccatcgatcaaacatctgaagaagcattggcaggagtagaaaaaggt
gcatatgtcgtttctaaatctaaaaacgaaacacctgacgctcttctcatcgcttccgga
tcagaggtaggtcttgcaattgaagcgcaggctgaattggcaaaagaaaatatcgatgtt
tctgttgtcagcatgccttcaatggaccgttttgagaaacaatctgatgaatacaaaaac
gaagtccttcctgcagatgtgaaaaaacgtcttgcaattgaaatgggctcatcatttgga
tggggcaaatacacggggcttgaaggtgacgttctcggcatagaccgattcggtgcatct
gctcctggtgaaaccatcattaacgaatacggcttctcagttccgaacgtagtgaatcga
gttaaggcattaatcaataagtaa

DBGET integrated database retrieval system