KEGG   Bacillus subtilis subsp. subtilis 168: BSU17900Help
Entry
BSU17900          CDS       T00010                                 

Gene name
yneE
Definition
(RefSeq) sporulation inhibitor of replication protein SirA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SirA
Motif
Other DBs
NCBI-GeneID: 936340
NCBI-ProteinID: NP_389673
Pasteur: BG11248
BSORF: BG11248
UniProt: P45707
Structure
PDB: 

Position
1922017..1922463
Genome map
AA seq 148 aa AA seqDB search
MERHYYTYLIKEEFANHYFGRESVMFELFQDYHWTSLEKQQYEMTEKQIQYITQPIPILH
MHQRLKMNLNKTDYRQLDYIYRIALPKAKGHATFMMKEHMIEIVASGDYEAETIFFEVLR
KVSPCFLAMDFNSKRYGWLNPVKERNFV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtcactactatacgtacctgatcaaagaggaatttgccaatcactatttcggc
cgggaatcggttatgtttgagctgtttcaagactatcattggacaagccttgaaaagcag
cagtatgaaatgacagagaaacagattcaatatattacacaaccaatcccgattttacat
atgcatcagcggttaaaaatgaatttaaacaagacggattacaggcagctggattatatt
tatagaatagctttgccgaaagcaaaaggccacgcgacgtttatgatgaaggagcacatg
atagaaattgtggcttcgggagattacgaggcagaaacgatattctttgaagtgttaaga
aaagtaagcccttgctttttagcaatggatttcaattcgaagcgttacggatggctaaat
ccggtgaaagaaagaaattttgtctaa

DBGET integrated database retrieval system