KEGG   Bacillus subtilis subsp. subtilis 168: BSU17910Help
Entry
BSU17910          CDS       T00010                                 

Gene name
yneF
Definition
(RefSeq) hypothetical protein
  KO
K09976  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU17910 (yneF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0154 Sbt_1 SNARE_assoc DUF2127 DUF4199 FtsX LRR19-TM
Motif
Other DBs
NCBI-GeneID: 939469
NCBI-ProteinID: NP_389674
Pasteur: BG11249
BSORF: BG11249
UniProt: P45708
Position
1922549..1922767
Genome map
AA seq 72 aa AA seqDB search
MTLWVGILVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKI
NQMMKAMNNQTK
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgactttatgggttggcatcctagtgggcgttgttgcattgctcataggtgttgcactc
gggttttttattgctcgtaaatatatgatgagctacctgaaaaagaatccgcctattaat
gaacaaatgttacgcatgatgatgatgcaaatgggaatgaaaccttctcaaaagaaaatc
aatcaaatgatgaaagccatgaataatcaaacgaaataa

DBGET integrated database retrieval system