KEGG   Bacillus subtilis subsp. subtilis 168: BSU17930Help
Entry
BSU17930          CDS       T00010                                 

Gene name
ccdA
Definition
(RefSeq) cytochrome c-type biogenesis protein CcdA
  KO
K06196  cytochrome c-type biogenesis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU17930 (ccdA)
Transporters [BR:bsu02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   BSU17930 (ccdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbD DsbD_2 Claudin_3 CRPA
Motif
Other DBs
NCBI-GeneID: 937140
NCBI-ProteinID: NP_389676
Pasteur: BG11240
BSORF: BG11240
UniProt: P45706
Position
1923234..1923941
Genome map
AA seq 235 aa AA seqDB search
MGDVNYFLTFGAGFLSFISPCCLPLYPAFLSYITGVSMDDVKTEKLLLQKRSLFHTLCFL
LGFSVIFIALGYGTSFIGSLFRDYHDAIRQIGALLIILFGFITLGVFRPEAMMKERRIHF
KHKPSGFLGSVLIGMAFAAGWTPCTGPILAAVITLAGTNPGSAVPYMMLYVLGFAVPFLL
LSFFITKLKWIRKNQLFIMKAGGVLMIVIGVLLFFNWMSLIIILLSDLFGGFTGF
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgtgaattattttttgacattcggagcggggtttttatcctttatttcgcct
tgctgcctgccgctttacccagcttttttgtcatatattacaggggtcagcatggacgat
gtaaaaactgaaaagctgctgctgcagaaaagaagcttgtttcatactttgtgttttttg
cttggcttttcagtcatttttattgctttaggctatggaacatcttttattggcagcctg
tttagggattatcacgatgcgattcggcaaattggcgcgttgcttattattttgttcggt
ttcattacactcggtgtgttccggcctgaggctatgatgaaagagcggagaatccatttt
aagcataaaccaagcgggtttttagggtcggtcttaatcggaatggcatttgcagctgga
tggacaccatgtaccggtccgatattagctgctgttatcacacttgcaggcaccaatccg
ggctcagcggtgccatacatgatgttatatgtactcggttttgcggtaccgtttctttta
ttgtctttttttatcacaaagctgaagtggataaggaagaaccagcttttcattatgaaa
gctggtggcgttttgatgattgtgattggtgtgctgttattctttaattggatgagcctg
atcattattttgctgtcagatctttttggaggctttactggtttttga

DBGET integrated database retrieval system