KEGG   Bacillus subtilis subsp. subtilis 168: BSU17960Help
Entry
BSU17960          CDS       T00010                                 

Gene name
yneK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2621 RE_MjaI
Motif
Other DBs
NCBI-GeneID: 938820
NCBI-ProteinID: NP_389679
Pasteur: BG11252
BSORF: BG11252
UniProt: P45711
Position
complement(1924993..1925421)
Genome map
AA seq 142 aa AA seqDB search
MLEGWFLWFILFWVIMMVVLLSIGGFFMFRKFLKRLPKEDGRSELDWQDYYIENSRHLWN
DENKQFLDELTAPVPELFRDAAKAKIAGKIGELALKEKVAKIDQQLMIKGYILATPKRDH
TFLKRHLRDKKIDLEPYQTLLK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaggatggtttttatggtttattctgttttgggtaatcatgatggtagtctta
ttatcaatcggcggttttttcatgtttcgaaagtttttaaagcgtttaccaaaagaggac
ggcagatcagagcttgattggcaggattactatattgaaaacagcagacatttatggaac
gatgaaaacaaacagtttctagatgaattgactgcgcccgtgccagagctgttcagagat
gcagcaaaagctaaaatcgcaggcaaaatcggtgagcttgcattaaaagaaaaggtagca
aagattgatcagcaacttatgatcaaaggctatattctcgcaactcctaaaagagaccat
accttcttaaaaaggcatctgcgggacaaaaaaatcgatttggaaccttatcagaccctt
ctcaaataa

DBGET integrated database retrieval system