KEGG   Bacillus subtilis subsp. subtilis 168: BSU17970Help
Entry
BSU17970          CDS       T00010                                 

Gene name
cotM
Definition
(RefSeq) spore coat protein M
  KO
K06335  spore coat protein M
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU17970 (cotM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArsA_HSP20 HSP20 Indigoidine_A
Motif
Other DBs
NCBI-GeneID: 938815
NCBI-ProteinID: NP_389680
Pasteur: BG11822
BSORF: BG11822
UniProt: Q45058
Position
complement(1925655..1926047)
Genome map
AA seq 130 aa AA seqDB search
MWRNASMNHSKRNDANDFDSMDEWLRQFFEDPFAWYDETLPIDLYETSQQYIIEADLTFL
QPTQVTVTLSGCEFILTVKSSGQTFEKQMMLPFYFNDKNIQVECENQILTVAVNKETEDG
SSFSLQFPLS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggaatgcttccatgaaccattcaaaacgcaacgatgcgaatgatttcgatagt
atggatgaatggcttcggcaattttttgaagaccccttcgcctggtacgacgaaacattg
cctattgatttatatgaaacaagtcagcagtatattatagaagcggatctgactttttta
cagcctacacaagtaacagttaccctttctggatgcgagttcatcttaactgtcaaatcg
tcaggacagacttttgaaaaacaaatgatgcttcctttttattttaatgacaaaaacatt
caagtcgaatgcgaaaatcaaatactcacagtcgccgtcaataaagaaacagaagatggc
tcttctttttctcttcaatttcctctcagctaa

DBGET integrated database retrieval system