KEGG   Bacillus subtilis subsp. subtilis 168: BSU17980Help
Entry
BSU17980          CDS       T00010                                 

Gene name
sspP
Definition
(RefSeq) small acid-soluble spore protein P
  KO
K06433  small acid-soluble spore protein P (minor)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU17980 (sspP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SspP
Motif
Other DBs
NCBI-GeneID: 938192
NCBI-ProteinID: NP_389681
Pasteur: BG11921
BSORF: BG11921
UniProt: P71032
Position
complement(1926128..1926274)
Genome map
AA seq 48 aa AA seqDB search
MTNKNTSKDMHKNAPKGHNPGQPEPLSGSKKVKNRNHTRQKHNSSHDM
NT seq 147 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataagaatacaagtaaagatatgcataaaaacgcccctaaaggacacaatccc
ggccaacccgagcctctaagcggaagcaaaaaagtaaaaaaccgaaaccatacaagacaa
aagcacaactcaagccatgatatgtaa

DBGET integrated database retrieval system