KEGG   Bacillus subtilis subsp. subtilis 168: BSU17990Help
Entry
BSU17990          CDS       T00010                                 

Gene name
sspO
Definition
(RefSeq) small acid-soluble spore protein O
  KO
K06432  small acid-soluble spore protein O (minor)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU17990 (sspO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SspO
Motif
Other DBs
NCBI-GeneID: 938222
NCBI-ProteinID: NP_389682
Pasteur: BG11920
BSORF: BG11920
UniProt: P71031
Position
complement(1926306..1926452)
Genome map
AA seq 48 aa AA seqDB search
MVKRKANHVINGMNDAKSQGKGAGYIENDQLVLTEAERQNNKKRKTNQ
NT seq 147 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaagaaaagcgaatcacgtcattaacggaatgaatgacgcaaaaagccaaggc
aaaggcgccggctatattgaaaacgaccagcttgtactgactgaagcagaacgccaaaat
aacaaaaaaagaaaaaccaatcaataa

DBGET integrated database retrieval system