KEGG   Bacillus subtilis subsp. subtilis 168: BSU18000Help
Entry
BSU18000          CDS       T00010                                 

Gene name
citB
Definition
(RefSeq) aconitate hydratase
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU18000 (citB)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU18000 (citB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     BSU18000 (citB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-GeneID: 938140
NCBI-ProteinID: NP_389683
Pasteur: BG10478
BSORF: BG10478
UniProt: P09339
Position
1926680..1929409
Genome map
AA seq 909 aa AA seqDB search
MANEQKTAAKDVFQARKTFTTNGKTYHYYSLKALEDSGIGKVSKLPYSIKVLLESVLRQV
DGFVIKKEHVENLAKWGTAELKDIDVPFKPSRVILQDFTGVPAVVDLASLRKAMAAVGGD
PDKINPEIPVDLVIDHSVQVDKAGTEDALAVNMDLEFERNAERYKFLSWAKKAFNNYQAV
PPATGIVHQVNLEFLASVVHAIEEDGELVTYPDTLVGTDSHTTMINGIGVLGWGVGGIEA
EAGMLGQPSYFPVPEVIGAKLVGKLPNGTTATDLALKVTQVLREKGVVGKFVEFFGPGIA
ELPLADRATIANMAPEYGATCGFFPVDEEALNYLRLTGRDPEHIDVVEAYCRSNGLFYTP
DAEDPQFTDVVEIDLSQIEANLSGPKRPQDLIPLSAMQETFKKQLVSPAGNQGFGLNAEE
ENKEIKFKLLNGEETVMKTGAIAIAAITSCTNTSNPYVLIGAGLVAKKAVELGLKVPNYV
KTSLAPGSKVVTGYLVNSGLLPYMKELGFNLVGYGCTTCIGNSGPLSPEIEEAVAKNDLL
ITSVLSGNRNFEGRIHPLVKGNYLASPPLVVAYALAGTVNINLKTDPIGVGKDGQNVYFN
DIWPSMDEINALVKQTVTPELFRKEYETVFDDNKRWNEIETTDEALYKWDNDSTYIQNPP
FFEEMSVEPGKVEPLKGLRVVGKFGDSVTTDHISPAGAIGKDTPAGKYLQEKGVSPRDFN
SYGSRRGNHEVMMRGTFANIRIKNQIAPGTEGGFTTYWPTGEVTSIYDACMKYKEDKTGL
VVLAGKDYGMGSSRDWAAKGTNLLGIRTVIAESFERIHRSNLVFMGVLPLQFKQGENADT
LGLTGKEVIEVDVDETVRPRDLVTVRAINEDGNVTTFEAVVRFDSEVEIDYYRHGGILQM
VLREKMKQS
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgagcaaaaaactgcagcaaaagacgttttccaagcgagaaaaacgtttact
acaaatgggaaaacatatcattactactctttaaaagcgttagaagattcaggtatagga
aaggtttcgaagcttccttattccatcaaagttcttttagaatcagtattgcgtcaagtt
gacggcttcgttatcaaaaaagaacacgtggaaaatttggcaaaatggggaactgccgaa
ttaaaggatatcgacgttccgttcaaaccgtctcgtgttattttacaagacttcacaggg
gttccggcagtagtagatctggcttcactgcgtaaagcaatggcagctgtcggcggagat
cctgataaaatcaaccctgaaattcctgttgatctcgttatcgatcactctgtacaggta
gataaagcgggtacagaagatgcattagcagtaaatatggacttggaattcgaaagaaat
gcagagcgctacaaatttttaagctgggcaaagaaagcgtttaacaattatcaggcagta
ccgcctgcaacaggtattgtgcaccaggtcaaccttgagttcttggcaagtgttgtccat
gccattgaagaagacggcgagcttgtaacgtatcctgatacgcttgtcggaacagactca
cacacaacaatgattaacggtatcggtgttctcggctggggtgtcggtggaattgaagct
gaagcgggaatgcttggacagccttcttacttcccagttccagaggtaatcggcgcgaaa
cttgtcggcaagcttccaaacggaacaacagctactgacttggcgttaaaagtaacacaa
gtgctgcgtgaaaaaggcgttgtcggtaaatttgttgaattcttcggaccgggaattgct
gaactgccgcttgcagatcgcgcaacaattgcgaatatggctccggaatacggtgctaca
tgcggattcttcccagtagatgaagaagcgcttaactacctgcgcctgactggccgtgat
cctgaacatattgatgttgttgaagcatactgcagaagcaatggcttgttctacactcca
gatgcggaagaccctcaatttactgatgtggttgaaattgacctgtctcaaattgaagca
aacttatcgggtccaaagcgtcctcaggatttgatcccgctatctgctatgcaggaaacg
tttaaaaagcaattagtcagccctgcaggtaaccaaggattcggtttaaatgctgaggaa
gaaaataaagaaattaagtttaaactccttaacggcgaagaaacagttatgaaaacgggt
gcgatcgccattgctgcgattacaagctgtacaaatacatcaaacccatacgtgctgatc
ggcgccggactggtagcgaaaaaagcggttgagttagggcttaaggtgcctaattacgtg
aaaacgtcacttgcaccgggttctaaagttgttacaggatatcttgtgaattcaggcctt
cttccatacatgaaagagcttggctttaacctcgttgggtacggctgtacaacatgtatc
gggaactcaggtccgctttcaccggaaatcgaagaagcggttgcgaaaaatgatcttctg
attacgtctgtcctttccggaaaccgtaactttgaaggacgtattcacccgcttgttaaa
ggcaactatcttgcttcaccgccgcttgttgtggcatatgcgctggctggaacggtaaac
attaacttaaaaaccgatccaatcggtgtgggcaaggatggtcaaaacgtatactttaat
gatatttggccgtcaatggacgaaatcaatgcacttgttaagcaaactgttacgccagag
ctattccgcaaagagtatgaaacagtatttgatgacaacaagcgctggaacgaaattgaa
acaacagatgaagctttatataaatgggataacgattcaacttacatccaaaacccacca
ttctttgaagagatgtctgttgagccaggcaaggttgagccattaaaaggactgcgtgtt
gtcggtaaattcggcgattcagtcacaactgaccatatttctcctgcgggggcaatcgga
aaagatacgcctgccggaaagtatttgcaagaaaaaggtgtttcacctcgtgactttaac
tcctacggctcccgccgtggaaaccatgaagtcatgatgagaggaacatttgccaacatt
cgcatcaaaaaccaaatcgcaccgggtacagaaggcggatttacgacgtactggccgact
ggtgaagtaacatccatctatgatgcatgcatgaaatacaaagaagataaaaccggtctt
gtcgtattagcaggaaaagactatggtatgggatcttcacgtgactgggctgcaaaagga
acaaaccttctcggcatcagaacggtcattgcagagagcttcgaaagaattcacagaagc
aatcttgtattcatgggtgtgctgccgcttcagtttaaacaaggtgaaaatgcggataca
ctcggcttaacgggtaaagaagtcatcgaggtagatgttgatgaaacagttcgtcctcgt
gaccttgtgactgtaagagcaatcaatgaagacggcaatgtaacaacttttgaagcagtc
gtccgctttgatagtgaagttgaaattgattactaccgccatggcggcatccttcaaatg
gtgcttcgtgaaaaaatgaagcagtcctga

DBGET integrated database retrieval system