KEGG   Bacillus subtilis subsp. subtilis 168: BSU18010Help
Entry
BSU18010          CDS       T00010                                 

Gene name
yneN
Definition
(RefSeq) thioredoxin
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin Thioredoxin_8 Thioredoxin Thioredoxin_2 TraF GSHPx SCO1-SenC Thioredoxin_7 T4_deiodinase TPR_21
Motif
Other DBs
NCBI-GeneID: 938193
NCBI-ProteinID: NP_389684
Pasteur: BG13451
BSORF: BG13451
UniProt: O31820
Position
1929481..1929993
Genome map
AA seq 170 aa AA seqDB search
MLKKWLAGILLIMLVGYTGWNLYQTYSKKEVGIQEGQQAPDFSLKTLSGEKSSLQDAKGK
KVLLNFWATWCKPCRQEMPAMEKLQKEYADKLAVVAVNFTSAEKSEKQVRAFADTYDLTF
PILIDKKGINADYNVMSYPTTYILDEKGVIQDIHVGTMTKKEMEQKLDLD
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaaatggctcgcagggatcctgcttatcatgctagtcggttatacgggatgg
aatttatatcaaacatacagcaaaaaagaagtcggaattcaagaggggcaacaagcacct
gatttttctttgaaaacgctatcaggagagaaaagctctttacaggatgcaaaaggcaaa
aaagtgctgctcaatttttgggcaacttggtgtaagccgtgccgtcaggaaatgcctgcg
atggaaaagctgcaaaaagagtacgccgacaaacttgcggttgttgcggtaaatttcact
tcagctgagaaaagtgagaaacaggtccgagcgtttgctgatacttatgacttaacgttc
cccattctgattgataaaaaagggatcaatgctgactataacgtgatgtcatatccaacg
acatatatcttagatgaaaaaggtgttatccaagacatacatgttggcaccatgacaaaa
aaagaaatggaacaaaaactggatcttgattag

DBGET integrated database retrieval system