KEGG   Bacillus subtilis subsp. subtilis 168: BSU18019Help
Entry
BSU18019          CDS       T00010                                 

Gene name
ynzL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fur_reg_FbpB DASH_Dam1
Motif
Other DBs
NCBI-GeneID: 8302958
NCBI-ProteinID: YP_003097732
UniProt: C0H418
Position
1930074..1930199
Genome map
AA seq 41 aa AA seqDB search
MKKMRKRSFHELVMENKKELMTNTEYLNQLEEKLEQRFKQK
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagatgagaaaacgttcttttcatgagctcgtcatggaaaacaaaaaagagctg
atgaccaatacagagtatttaaatcagcttgaggaaaagcttgaacagcgatttaagcaa
aaataa

DBGET integrated database retrieval system