KEGG   Bacillus subtilis subsp. subtilis 168: BSU18020Help
Entry
BSU18020          CDS       T00010                                 

Gene name
sspN
Definition
(RefSeq) small acid-soluble spore protein N
  KO
K06431  small acid-soluble spore protein N (minor)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU18020 (sspN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SspN
Motif
Other DBs
NCBI-GeneID: 2914184
NCBI-ProteinID: YP_054579
Pasteur: BG14179
BSORF: BG14179
UniProt: Q7WY69
Position
1930264..1930410
Genome map
AA seq 48 aa AA seqDB search
MGNNKKNGQPQYAPSHLGTKPVKYKANKGEKMHDTSGQRPIIMQTKGE
NT seq 147 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaacaagaaaaacggtcagcctcaatatgctccaagccacttgggtacaaag
cctgtaaaatataaagccaataaaggggaaaaaatgcatgatacttcaggacagcggccg
attatcatgcagacaaaaggcgagtag

DBGET integrated database retrieval system