KEGG   Bacillus subtilis subsp. subtilis 168: BSU18030Help
Entry
BSU18030          CDS       T00010                                 

Gene name
tlp
Definition
(RefSeq) small acid-soluble spore protein Tlp
  KO
K06434  small acid-soluble spore protein (thioredoxin-like protein)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU18030 (tlp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oberon_cc FliT DUF1863 Muted
Motif
Other DBs
NCBI-GeneID: 938091
NCBI-ProteinID: NP_389685
Pasteur: BG11806
BSORF: BG11806
UniProt: Q45060
Position
1930447..1930698
Genome map
AA seq 83 aa AA seqDB search
MTKNQNQYQQPNPDDRSDNVEKLQDMVQNTIENIEEAEASMEFASGEDKQRIKEKNARRE
QSIEAFRNEIQDESAARQNGYRS
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaccaaaatcaatatcagcagcctaatcctgatgatcgttctgacaatgtg
gaaaaattgcaggatatggttcaaaatacaattgaaaatatagaagaagcagaagcatca
atggagtttgcttcaggagaagataaacagcgtatcaaagaaaaaaatgcaaggcgcgaa
cagagcattgaagcgtttcgtaatgaaatacaggacgaatctgcagcgagacaaaacgga
taccgttcttaa

DBGET integrated database retrieval system