KEGG   Bacillus subtilis subsp. subtilis 168: BSU18040Help
Entry
BSU18040          CDS       T00010                                 

Gene name
yneP
Definition
(RefSeq) acyl-CoA thioesterase
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU18040 (yneP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BSU18040 (yneP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT Acyl-ACP_TE 4HBT_2
Motif
Other DBs
NCBI-GeneID: 2914242
NCBI-ProteinID: YP_054580
Pasteur: BG11823
BSORF: BG11823
UniProt: Q45061
Position
1930834..1931199
Genome map
AA seq 121 aa AA seqDB search
MGIVYHANYLVWMEVGRTALIKDLGFLYSDMEKKGVLSPVVDINISYKKPLHYGETAVVH
TWIEDYNGFKTVYGYHIYNPAGELSIKATSSHICVDKESFKPIQFRKAFPDWHTAYEKAK
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggggattgtctatcacgcaaattatcttgtgtggatggaggtcggcagaacggccttg
attaaggacttaggctttttatatagtgatatggaaaaaaaaggcgttctgtccccagtc
gttgatatcaatatttcctataaaaagccgcttcattacggagaaaccgcggttgtacat
acatggatagaggactataacggatttaaaaccgtctatggttaccacatttataatccg
gccggtgagctttccatcaaagccacctcatctcatatttgtgtggataaagaaagcttt
aagccaattcaattccgcaaagcttttcctgattggcacacagcatatgaaaaggccaaa
aaatag

DBGET integrated database retrieval system