KEGG   Bacillus subtilis subsp. subtilis 168: BSU18050Help
Entry
BSU18050          CDS       T00010                                 

Gene name
yneQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4031
Motif
Other DBs
NCBI-GeneID: 937998
NCBI-ProteinID: NP_389687
Pasteur: BG11824
BSORF: BG11824
UniProt: Q45062
Position
1931215..1931514
Genome map
AA seq 99 aa AA seqDB search
MAFGVKREELNRWKQAVKRGEIAFLTHYWLDDRFPEAKTVTKAGCADIDKLVQWGAAYGL
KKEWIHKKSEFPHFDLLGETQKYILEQENLTDHLIRFHL
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttggtgtgaaacgggaggaacttaaccggtggaaacaagcagtgaaaagagga
gaaatcgcatttttaacacattactggctggatgaccgatttccagaagcaaagaccgtg
acaaaagccggctgtgcagacattgataagctggttcagtggggagcggcgtacgggtta
aaaaaagaatggatccataagaaaagtgaatttccccactttgatctgctgggggaaaca
caaaaatatattttggaacaagaaaacctaaccgatcatcttatacgatttcatttgtaa

DBGET integrated database retrieval system