KEGG   Bacillus subtilis subsp. subtilis 168: BSU18060Help
Entry
BSU18060          CDS       T00010                                 

Gene name
yneR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-S_biosyn
Motif
Other DBs
NCBI-GeneID: 938132
NCBI-ProteinID: NP_389688
Pasteur: BG11825
BSORF: BG11825
UniProt: Q45063
Position
complement(1931545..1931832)
Genome map
AA seq 95 aa AA seqDB search
MNMTINEDALNWYKEELDLESGDQVRFFVRYGGCSNVQKGFSLGVAKDAPQEAGVTAEAD
GITFFIEESDLWYFDNHDLLVSYSEDADEPVFEYQ
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgacaattaacgaagacgcattgaactggtataaagaagaactcgatttggaa
agcggagaccaggttcgctttttcgtccgctatggaggctgcagcaacgttcaaaagggt
ttttctctcggtgtagcgaaagatgccccacaagaggctggagtcactgcagaagctgat
ggcattaccttctttattgaagaaagtgatttatggtactttgataaccacgaccttctc
gtcagctattcagaagacgctgatgaaccggtttttgaataccaataa

DBGET integrated database retrieval system